(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE69

ALDEN1_2.PE69        Location/Qualifiers
FT   CDS_pept        77965..78771
FT                   /locus_tag="Alide_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_4097"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_4097 hypothetical protein"
FT                   /db_xref="GI:319760807"
FT                   /db_xref="GeneID:10102092"
FT                   /translation="MQTYRNWRVIWRCWRRRSQSQLGNPGSQSLQGRCCSRMLDHQQIA
FT                   DALGLARRQLRVTAICYPAAIRVIGRTEVYRQIAEVRIDGKVKLTQPIGYAFPAGAVFS
FT                   TALRQGDRFARVSRVYDQQSWDGVTWYDGLDPSKGAATATYDTTNYPIEVNNRGAITER
FT                   WALRFRSGGQVFDFIGQHLGQIASGNVNEDFSPMNIAAGAPYMTIRAGGWGSGWAAGNV
FT                   LFPDTIGAEAPIDCVRCVQPGSPAGIDDRAWIVQRGDVGRDPESDF"
FT                   /protein_id="YP_004124744.1"
     ATGCAGACCT ACCGCAACTG GCGCGTGATC TGGAGATGCT GGCGCAGACG CAGCCAGAGC        60
     CAGCTTGGCA ATCCGGGCTC GCAGAGCTTG CAGGGGCGCT GTTGCTCGCG CATGCTGGAC       120
     CATCAGCAAA TCGCTGATGC ACTGGGCCTC GCTAGGCGTC AGCTTCGCGT TACGGCAATT       180
     TGTTACCCGG CCGCCATCCG CGTGATCGGC CGAACCGAGG TCTACCGTCA AATCGCCGAA       240
     GTGCGCATCG ACGGCAAGGT CAAGCTCACG CAGCCCATCG GCTACGCCTT CCCGGCCGGG       300
     GCCGTGTTCT CGACGGCGCT GCGCCAGGGT GACCGCTTCG CGCGCGTCAG CCGCGTATAC       360
     GACCAGCAGA GCTGGGACGG CGTGACCTGG TACGACGGTC TCGACCCGAG CAAGGGCGCG       420
     GCCACTGCGA CATACGACAC CACGAACTAC CCGATCGAGG TCAACAACCG CGGGGCGATC       480
     ACGGAACGCT GGGCGCTGCG CTTCCGCTCG GGCGGCCAGG TCTTCGACTT CATCGGCCAG       540
     CACCTGGGCC AGATCGCCTC CGGCAATGTG AACGAAGACT TCTCGCCGAT GAACATCGCG       600
     GCCGGCGCTC CCTACATGAC GATCCGCGCG GGCGGCTGGG GCAGCGGCTG GGCGGCAGGC       660
     AACGTGCTGT TCCCCGACAC CATCGGCGCA GAGGCCCCGA TCGACTGCGT GCGCTGCGTG       720
     CAGCCCGGCT CGCCGGCTGG CATCGATGAC CGCGCCTGGA TCGTGCAGCG CGGCGACGTC       780
     GGCCGAGACC CCGAGAGCGA CTTCTAA                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page