(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE7

ALDEN1_2.PE7         Location/Qualifiers
FT   CDS_pept        8188..9030
FT                   /locus_tag="Alide_0007"
FT                   /gene_family="HOG000233517" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: reh:H16_A2139 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760745"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102030"
FT                   /translation="MRNLDIGLLRTFVAVAERESFTNAAEKVYRTQAAVSQQMQKLESV
FT                   LGCALFERVGRRKKLTVEGVRLLEYARRMVGLNDEAYRVITQQAATQPVKIGACADAVD
FT                   TLLPAYLEICAENFPNLSIDIQVGRSRWLASALRKGDIDLMLDITPHPEFAHTVLRTSP
FT                   VAWIAGARYHPQAGASVPLILMEAACPFRSSMVQALTEAGIPWHAAFETSTLAGVRAAL
FT                   RAGLGVTARAVEMLAPDLRVLDPQARLPALPPISFCLYWRADASHESAMKVRHLIAPH"
FT                   /protein_id="YP_004124682.1"
     ATGCGCAACC TCGATATCGG CCTGCTGCGC ACCTTCGTGG CGGTGGCGGA GCGCGAGAGC        60
     TTCACCAACG CCGCCGAGAA GGTCTACCGC ACGCAGGCGG CGGTGTCCCA GCAGATGCAG       120
     AAGCTCGAAT CCGTGCTGGG CTGCGCGCTG TTCGAGCGCG TGGGCCGGCG CAAGAAGCTG       180
     ACCGTGGAGG GCGTGCGGCT GCTGGAATAC GCGCGGCGCA TGGTCGGCCT CAACGACGAG       240
     GCCTACCGCG TCATCACCCA GCAGGCGGCC ACCCAGCCGG TGAAGATCGG CGCCTGCGCC       300
     GACGCCGTGG ACACCCTGCT GCCCGCCTAC CTGGAGATCT GCGCCGAGAA CTTCCCCAAC       360
     CTGAGCATCG ACATCCAGGT CGGGCGCAGC CGCTGGCTCG CGTCGGCGCT GCGCAAGGGC       420
     GACATCGACC TGATGCTGGA CATCACCCCG CACCCCGAGT TCGCGCACAC GGTGCTGCGC       480
     ACCTCGCCCG TGGCCTGGAT CGCCGGAGCG CGCTACCACC CGCAGGCCGG CGCCTCGGTG       540
     CCGCTGATCC TGATGGAGGC GGCCTGCCCT TTCCGCAGCA GCATGGTGCA GGCGCTGACC       600
     GAGGCCGGCA TCCCCTGGCA CGCGGCCTTC GAGACATCGA CCCTGGCCGG CGTGCGCGCC       660
     GCGCTGCGCG CGGGGCTGGG CGTGACGGCG CGCGCGGTGG AGATGCTGGC GCCCGACCTG       720
     CGCGTGCTCG ACCCGCAGGC CCGCCTGCCG GCGCTGCCGC CGATCAGCTT CTGCCTGTAC       780
     TGGCGCGCCG ACGCCAGCCA TGAAAGCGCG ATGAAGGTCC GCCATCTCAT TGCACCCCAT       840
     TAG                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page