(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE70

ALDEN1_2.PE70        Location/Qualifiers
FT   CDS_pept        78805..79977
FT                   /locus_tag="Alide_0070"
FT                   /gene_family="HOG000225325" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pnap_2245"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_2245 hypothetical protein"
FT                   /db_xref="GI:319760808"
FT                   /db_xref="GeneID:10102093"
FT                   /translation="MATYPVKYITNTMRGAPQISGQAGTLQAALRTFLLTGFGLTTALS
FT                   VTVAGGIATASLNEGQTFAQGCVVLVDGGTPAQINGEARVLTSSNSAITWATTAPDGPA
FT                   TGTITIKVAPVGGWEELFPGTPNKSVFRSIDPQASGFCYRVDDSGTTQARVRGFESMTD
FT                   IDTGTGPFPTDTQISGGGYTAKSYSEGATPVSYLLAADSRTVLIAISSYSSILATYTVA
FT                   PIRGFGDMLPLAPDGDPYSAAISCNSNSGTASFGAFGFYRSGAASIYCPRPRGGIGSAV
FT                   RADTYPYVGNAATVSGADPKLGAFPSDVDGELKYCRQYIAAGENLTPRADVPGVLYIPQ
FT                   TGVGALIKSGDTLQGSGALAGRTLRAVGANSSADAEPVGAWLIDVTGPWR"
FT                   /protein_id="YP_004124745.1"
     ATGGCTACCT ATCCCGTCAA GTACATCACC AACACCATGC GCGGCGCGCC GCAGATTTCC        60
     GGTCAGGCAG GCACGCTGCA GGCCGCGCTG CGCACGTTTC TGCTGACCGG CTTCGGGCTG       120
     ACAACAGCGC TGTCGGTCAC CGTGGCAGGA GGCATCGCCA CGGCCTCGCT CAATGAGGGC       180
     CAGACGTTCG CGCAGGGCTG CGTTGTCCTG GTGGACGGCG GCACGCCCGC GCAGATCAAC       240
     GGCGAGGCGC GCGTGCTCAC GTCGAGCAAC AGCGCGATCA CCTGGGCAAC CACGGCGCCG       300
     GATGGGCCGG CAACGGGCAC GATCACTATC AAAGTGGCGC CGGTGGGCGG CTGGGAAGAG       360
     TTGTTTCCCG GCACCCCGAA CAAGTCCGTG TTCCGCAGCA TTGATCCGCA GGCCTCGGGC       420
     TTCTGCTATC GCGTGGATGA CAGCGGCACG ACGCAAGCGC GCGTGCGCGG CTTCGAGTCG       480
     ATGACCGACA TCGACACCGG GACTGGGCCA TTCCCCACAG ACACACAGAT CAGTGGCGGC       540
     GGCTACACGG CCAAGTCCTA TTCCGAAGGT GCGACGCCGG TGTCGTACCT TCTCGCCGCC       600
     GACTCGCGGA CTGTGCTGAT CGCCATCTCG TCGTACAGCT CAATACTTGC GACGTACACC       660
     GTCGCGCCAA TTCGGGGTTT CGGCGACATG CTTCCATTGG CCCCCGACGG TGACCCCTAC       720
     AGCGCCGCAA TCAGCTGCAA CAGCAACTCC GGCACGGCCA GTTTCGGTGC CTTCGGCTTC       780
     TACCGCAGCG GCGCTGCCAG CATCTATTGC CCGCGCCCTC GGGGCGGGAT CGGGAGTGCG       840
     GTGAGAGCCG ACACCTACCC CTACGTAGGC AATGCGGCCA CAGTTTCCGG AGCAGATCCA       900
     AAACTCGGAG CCTTCCCGTC GGATGTCGAT GGGGAACTCA AGTATTGCCG CCAGTACATC       960
     GCCGCAGGCG AAAACCTCAC GCCACGCGCA GACGTCCCCG GCGTGCTCTA CATCCCGCAA      1020
     ACAGGCGTCG GCGCCCTGAT CAAATCGGGC GACACCCTCC AGGGCTCTGG CGCCCTGGCG      1080
     GGTCGCACGC TTCGCGCTGT GGGCGCAAAT TCGTCGGCCG ACGCGGAACC CGTCGGCGCC      1140
     TGGCTGATCG ACGTCACGGG GCCGTGGCGT TAG                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page