(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE71

ALDEN1_2.PE71        Location/Qualifiers
FT   CDS_pept        79986..80393
FT                   /locus_tag="Alide_0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:sce2651"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce2651 carbohydrate ABC transporter"
FT                   /db_xref="GI:319760809"
FT                   /db_xref="GeneID:10102094"
FT                   /translation="MAALAYIASFVGLAGAVTPSTAPPRFTAATAIGLLSNQGGRNWRF
FT                   FGDTSGTVLNNNRVMVKPSATAPEVPFAGARVRLHRLTDGYCAWEGISDAAGYYWPRGL
FT                   EVGLLYYPVAIDLTGTHECDAAGPVIAVRAP"
FT                   /protein_id="YP_004124746.1"
     ATGGCCGCTC TTGCATACAT CGCATCCTTC GTCGGCCTGG CGGGCGCCGT CACGCCTTCC        60
     ACGGCGCCGC CCCGCTTCAC CGCCGCCACG GCGATAGGGT TGTTATCCAA TCAAGGAGGG       120
     CGCAACTGGC GCTTCTTCGG TGACACCAGC GGCACCGTGC TCAACAACAA CCGCGTGATG       180
     GTCAAGCCGT CGGCCACCGC GCCCGAGGTG CCATTCGCGG GCGCGCGGGT GCGCCTGCAC       240
     AGGCTGACGG ACGGCTACTG CGCATGGGAA GGCATCTCCG ACGCCGCGGG CTACTACTGG       300
     CCGCGCGGCC TGGAAGTGGG CCTGCTGTAC TACCCCGTGG CCATTGACCT CACGGGCACT       360
     CATGAGTGCG ACGCGGCCGG GCCGGTCATT GCAGTGAGGG CGCCCTGA                    408
//

If you have problems or comments...

PBIL Back to PBIL home page