(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE74

ALDEN1_2.PE74        Location/Qualifiers
FT   CDS_pept        82819..83040
FT                   /locus_tag="Alide_0074"
FT                   /gene_family="HOG000225321" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pnap_2241"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_2241 hypothetical protein"
FT                   /db_xref="GI:319760812"
FT                   /db_xref="GeneID:10102097"
FT                   /translation="MPNLYQQLRELLAPGRVQIGEVVAYTDGVATIDLPGAGQVRARGE
FT                   AAVGGKVFVQDGVIQGPAPDLPVFVDVI"
FT                   /protein_id="YP_004124749.1"
     ATGCCTAACC TCTATCAACA GCTGCGCGAG CTGCTCGCGC CCGGCCGGGT GCAGATCGGC        60
     GAGGTGGTGG CCTACACGGA CGGCGTCGCA ACGATCGATC TGCCCGGCGC GGGCCAGGTC       120
     CGCGCGCGTG GGGAGGCCGC GGTGGGCGGC AAGGTATTCG TTCAAGACGG GGTGATCCAG       180
     GGGCCGGCCC CTGATCTGCC CGTGTTCGTG GACGTGATTT GA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page