(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE76

ALDEN1_2.PE76        Location/Qualifiers
FT   CDS_pept        84303..84878
FT                   /locus_tag="Alide_0077"
FT                   /gene_family="HOG000291639" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.17"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; KEGG:
FT                   dia:Dtpsy_0063 ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase"
FT                   /db_xref="GI:319760814"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008817"
FT                   /db_xref="InterPro:IPR002779"
FT                   /db_xref="InterPro:IPR017858"
FT                   /db_xref="GeneID:10102100"
FT                   /translation="MGNRLTQIATRTGDDGTTGLGDNTRVSKASGRPHAMGDVDELNSH
FT                   IGLLLCEPMPQDVRELLIDVQHQLFNLGGELCMPGYELLKDDALLQLDNALARYNAELP
FT                   RLQEFILPAGTRAACQAHVCRTVARRAERAVVALQQAETMRAAPRQYLNRLSDLLFVLS
FT                   RVLNRMDGGNEVYWKSERLARQADDATE"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /protein_id="YP_004124751.1"
     ATGGGAAACA GACTGACACA GATCGCAACG CGCACCGGCG ACGACGGCAC CACCGGCCTG        60
     GGCGACAACA CGCGCGTGTC CAAGGCCAGC GGCCGCCCGC ATGCCATGGG CGACGTGGAC       120
     GAGCTCAACT CCCACATCGG CCTGCTGCTG TGCGAGCCCA TGCCGCAGGA CGTGCGCGAA       180
     CTGCTGATCG ACGTGCAGCA CCAGCTGTTC AACCTGGGCG GCGAGCTGTG CATGCCCGGC       240
     TACGAGCTGC TCAAGGACGA TGCGCTGCTG CAGCTGGACA ACGCGCTGGC GCGCTACAAC       300
     GCCGAGCTGC CGCGGCTGCA GGAGTTCATC CTGCCCGCGG GCACGCGCGC GGCCTGCCAG       360
     GCCCATGTGT GCCGCACGGT GGCGCGCCGC GCCGAGCGCG CCGTGGTCGC TCTGCAGCAG       420
     GCCGAGACCA TGCGCGCCGC GCCGCGCCAG TACCTGAACC GCCTGTCCGA CCTGCTGTTC       480
     GTGCTCTCGC GCGTGCTCAA CCGCATGGAC GGCGGCAACG AGGTGTACTG GAAGAGCGAG       540
     CGCCTGGCGC GGCAGGCGGA TGATGCTACT GAATAG                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page