(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE77

ALDEN1_2.PE77        Location/Qualifiers
FT   CDS_pept        complement(84939..85361)
FT                   /locus_tag="Alide_0078"
FT                   /gene_family="HOG000066991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ajs:Ajs_0044 hypothetical protein"
FT                   /db_xref="GI:319760815"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:10102101"
FT                   /translation="MSIWKTPISLASVNAHTAHTAISHLGIEFLEVGDDFLRARVPVDE
FT                   RTRQPYGILHGGVSVVLAETLGSMGAANACPPDHRVVGLDINANHIRATSSGWVTGTAR
FT                   PVHIGKSTQVWQIDMVNDEGQLTCVSRITMAVLQPR"
FT                   /protein_id="YP_004124752.1"
     atgtccatct ggaagacacc catctcactg gcgtccgtca acgcccacac cgcccacacc        60
     gccatcagcc acctgggcat agagttcctg gaggtgggcg acgatttcct gcgcgcccgc       120
     gtgcccgtgg acgagcgcac gcgccagccc tacggcatcc tgcacggcgg cgtgagcgtg       180
     gtgctggccg agacgctggg ctccatgggc gccgccaacg cctgcccgcc ggaccaccgc       240
     gtcgtgggcc tggacatcaa cgccaaccac atacgcgcca ccagcagcgg ctgggtcacg       300
     ggcacggcgc ggccggtgca tatcggaaag tccacgcagg tgtggcagat cgacatggtc       360
     aatgacgagg gccagctgac ctgcgtctcg cgcatcacca tggcggtgct gcagccgagg       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page