(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE8

ALDEN1_2.PE8         Location/Qualifiers
FT   CDS_pept        complement(9027..10049)
FT                   /locus_tag="Alide_0008"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_A2140"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2140 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319760746"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102031"
FT                   /translation="MQILNHESRLSRRELLRSAGAMGLGMAAGLPALAQGAGAADFRLD
FT                   KQVRIIVAYGAGGASDAIARYVGDAIAQRGGKPVIVENRPGADGNIAAEAVVRAPTDAY
FT                   NLLVSGSSTHAANATIYKKLAYDPDKDFTPLATMANTPYAMLVNPKRIAQTTAADFLAW
FT                   ARKDGQTLSFASANVGGRIAGERFKQLTRINAVNVPYKSSAQAMTDLIGGQFDYYFCDM
FT                   LTALPQIKAGTVRALALSSSKRIASLPDVPTVAELGYPDFDVSSWIAIWSARATTPQPV
FT                   SAALSRWIGEALESPAGQDFLVKKGLVPTPVSPEHLLHLQARDTRDWGRIIIEAGMQQP
FT                   "
FT                   /protein_id="YP_004124683.1"
     atgcagatac tgaatcacga gtcccggttg tcacgccgcg aactgctgcg cagcgcgggc        60
     gccatggggt tgggcatggc ggcgggcctg cccgccctgg cccagggcgc gggcgccgca       120
     gacttcaggc tcgacaagca ggtgcgcatc atcgtcgcct atggggcggg cggcgcgtcg       180
     gacgccattg cgcgctacgt gggcgacgcc atcgcccagc gcggcggcaa gccggtgatc       240
     gtggagaacc gccccggcgc ggacggcaac atcgcggccg aggccgtggt gcgcgcgccg       300
     accgatgcct acaacctgct ggtgtcgggc tcgtccaccc atgcggccaa cgccacgata       360
     tacaagaagc tggcctacga cccggacaag gacttcacgc cgctggccac catggccaat       420
     acgccgtacg caatgctggt caaccccaag cgcatcgcgc agaccacggc cgcggacttc       480
     ctggcctggg cccgcaagga cggacagacc ctgtcgttcg ccagcgccaa cgtgggcggg       540
     cgcatcgcgg gcgagcgctt caagcagctc accaggatca acgcggtgaa cgtgccctac       600
     aagagcagcg cccaggccat gacggacctg atcggcggcc agttcgacta ctacttctgc       660
     gacatgctga cggcgctgcc gcagatcaag gccggcacgg tgcgggcgct cgcgctgtcg       720
     agcagcaagc gcatcgccag cctgccggac gtgcccaccg tggccgagct gggctatccc       780
     gacttcgacg tcagctcctg gatcgcgatc tggagcgcca gggccaccac gccgcagccc       840
     gtgtcggccg cgttgtcgcg ctggatcggc gaggcgctgg aatcgcccgc ggggcaggac       900
     ttcctcgtca agaagggcct ggtgcccacg ccggtctcgc ccgagcacct gctgcacctg       960
     caggcacgcg acaccaggga ctggggccgg atcatcatcg aagccgggat gcagcagccc      1020
     taa                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page