(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE81

ALDEN1_2.PE81        Location/Qualifiers
FT   CDS_pept        88941..89951
FT                   /locus_tag="Alide_0082"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_B4598"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4598 hypothetical protein"
FT                   /db_xref="GI:319760819"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102105"
FT                   /translation="MFGRANRRKFFQSTTAGAISAAAFGSALTPHWAWAQSPDGYPSRA
FT                   IRVVVPFTPGGGTDVVGRALMEALSRELGQAIIVDNKPGGGTVIGSDLVAKAPADGYTL
FT                   LLTTSALAINDSLVPKLPYKTARDITEVGLICTGPNVFVVRPESPYRSVADLIQAAKAR
FT                   PGRLTYGSSGNGSSVHLAAELFKLMAQVDITHVPYRGAGPAYTDLMGGQIDFVVGTAGG
FT                   VAKLVEAGKMRAIAVTSEKRTSAYKDIPTVAETLPGYAADVWYGIFAPAGTPPDVIAKL
FT                   NAALAKAANAPAYKQRLSNEGLTVAVNSPAEMTRFMRAEEARWRKVVVEGKVSVD"
FT                   /protein_id="YP_004124756.1"
     ATGTTTGGAC GTGCAAACCG CCGCAAGTTT TTCCAAAGCA CGACAGCTGG GGCCATTTCG        60
     GCCGCAGCCT TCGGCTCGGC CTTGACGCCC CATTGGGCAT GGGCGCAATC GCCGGACGGC       120
     TACCCGTCGC GGGCGATCCG GGTGGTGGTG CCTTTCACGC CCGGCGGAGG AACCGACGTG       180
     GTGGGCCGGG CACTGATGGA GGCGCTGTCG CGCGAGCTGG GTCAGGCCAT CATCGTGGAC       240
     AACAAGCCCG GCGGCGGTAC CGTCATCGGC TCCGACCTCG TGGCCAAGGC GCCGGCGGAC       300
     GGCTACACCC TGCTGCTCAC GACGTCGGCG CTGGCCATCA ACGATTCGCT GGTTCCCAAG       360
     CTGCCTTACA AGACGGCCAG GGACATCACC GAAGTGGGGT TGATATGCAC GGGGCCGAAC       420
     GTGTTCGTCG TGCGTCCCGA AAGCCCCTAC CGTTCGGTCG CCGACCTGAT CCAGGCGGCC       480
     AAGGCGCGTC CTGGCCGCCT GACCTATGGC TCCTCCGGCA ATGGCTCCTC GGTGCATTTG       540
     GCGGCCGAGC TGTTCAAGCT CATGGCCCAG GTGGACATCA CGCATGTCCC CTACCGCGGC       600
     GCAGGGCCTG CCTATACCGA CCTCATGGGA GGGCAGATCG ACTTCGTCGT CGGAACCGCG       660
     GGCGGCGTGG CCAAGCTGGT CGAGGCCGGC AAGATGCGCG CGATTGCCGT GACTTCCGAA       720
     AAACGTACAT CCGCCTACAA AGACATTCCC ACCGTCGCCG AGACCTTGCC GGGCTATGCC       780
     GCCGACGTCT GGTACGGCAT CTTCGCTCCC GCCGGCACGC CGCCCGACGT GATCGCCAAA       840
     CTCAATGCCG CCCTCGCGAA AGCCGCGAAT GCGCCTGCCT ACAAGCAGCG CCTGAGCAAT       900
     GAAGGGCTGA CCGTAGCGGT GAACTCTCCT GCCGAAATGA CCCGGTTCAT GCGCGCCGAG       960
     GAGGCACGCT GGCGCAAGGT CGTGGTGGAG GGCAAGGTCA GCGTCGATTG A               1011
//

If you have problems or comments...

PBIL Back to PBIL home page