(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE82

ALDEN1_2.PE82        Location/Qualifiers
FT   CDS_pept        90000..90806
FT                   /locus_tag="Alide_0083"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bbr:BB2766 short chain dehydrogenase"
FT                   /db_xref="GI:319760820"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102106"
FT                   /translation="MTTTSQRLAGKVAIIVGAGQQPGETVGNGRAVAERFAEEGARLLL
FT                   VDIQPESLKDTEDKLRSMGAEVASVLADITREDDCARIAAQCVATFGRIDVLHNNVGRS
FT                   KGDKSTVELGADMWDEIMAMNLKGMFMTCKHVLPQMIAQKEGSIINISSTSSLSARPTV
FT                   AYKTSKGAVNTFTQHLAYENAAHGVRANAILPGLIDTPMAIERRARERGVSREIVRAER
FT                   EAMVPMKRMGTAWDVAHAAVFLASDESRYVTGVLLPVDGGLVCKRG"
FT                   /protein_id="YP_004124757.1"
     ATGACAACTA CATCGCAGCG CCTTGCAGGC AAGGTGGCCA TCATCGTCGG CGCAGGCCAG        60
     CAGCCTGGCG AGACCGTCGG CAACGGCCGT GCCGTTGCCG AACGCTTTGC GGAAGAAGGC       120
     GCCCGCCTGC TTCTGGTGGA CATCCAGCCG GAATCGCTCA AGGACACGGA AGACAAGCTG       180
     CGCTCCATGG GCGCGGAAGT CGCCAGCGTG CTGGCGGACA TCACCCGCGA AGACGACTGC       240
     GCACGCATCG CGGCGCAATG CGTGGCCACG TTCGGGCGCA TCGACGTCCT GCACAACAAC       300
     GTGGGGCGCT CCAAGGGGGA CAAGTCCACC GTGGAGCTGG GCGCGGACAT GTGGGATGAG       360
     ATCATGGCCA TGAACCTCAA GGGCATGTTC ATGACCTGCA AACACGTGCT GCCGCAGATG       420
     ATCGCGCAGA AAGAGGGCAG CATCATCAAC ATATCGTCCA CGTCATCGCT GTCTGCGCGG       480
     CCCACGGTGG CCTACAAGAC CAGCAAGGGG GCGGTCAACA CCTTCACCCA GCACCTGGCC       540
     TACGAGAATG CCGCCCATGG CGTGCGCGCC AACGCCATCC TGCCGGGCCT GATCGATACC       600
     CCCATGGCCA TCGAGCGGCG AGCCCGGGAG CGCGGGGTCT CGCGCGAGAT CGTGCGTGCG       660
     GAGCGCGAGG CCATGGTGCC CATGAAGCGC ATGGGAACGG CGTGGGATGT CGCCCATGCC       720
     GCGGTATTCC TCGCGTCGGA CGAGTCGCGC TACGTCACGG GCGTGCTGCT GCCCGTGGAC       780
     GGCGGGCTGG TCTGCAAGCG GGGCTAG                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page