(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE83

ALDEN1_2.PE83        Location/Qualifiers
FT   CDS_pept        90808..91569
FT                   /locus_tag="Alide_0084"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0736 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760821"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102107"
FT                   /translation="MNLRLQGSHVLVTGASRGIGKACVRAFLDEGATVSALARTQQTLE
FT                   AMAAQMQAGDRLRVFCADLQDAAQAQEAVRRIEAQGGPIQVLVNCAGAAKRTPFAQLQP
FT                   ADWHAGMQAKFYSYMHVLTPVVQRMAGRGAGAVVNVVGAGGKRANPVHLAGGAANAALM
FT                   LAGTGLAAAYAPSGVRINTINPGQVRTERLQAQRDAQAAAGGAPLAEPPLGRPAEPEEI
FT                   AALAVFLASPRASYVSGAVIAMDGVALPTVV"
FT                   /protein_id="YP_004124758.1"
     ATGAATCTGC GACTGCAAGG CAGCCATGTG CTGGTGACGG GGGCAAGCCG CGGCATCGGC        60
     AAGGCCTGCG TACGCGCTTT CCTAGACGAG GGCGCCACGG TGAGCGCGCT GGCGCGCACG       120
     CAGCAGACGC TGGAGGCCAT GGCTGCGCAG ATGCAGGCAG GCGACCGCCT GCGCGTCTTC       180
     TGCGCGGACC TGCAGGATGC CGCGCAGGCA CAAGAGGCCG TCCGGCGCAT CGAAGCCCAG       240
     GGCGGCCCGA TACAGGTGCT CGTGAACTGC GCCGGTGCCG CCAAGCGAAC GCCCTTTGCG       300
     CAGTTGCAGC CTGCAGACTG GCATGCCGGG ATGCAGGCCA AGTTCTACTC CTACATGCAC       360
     GTCCTGACTC CCGTCGTGCA GCGCATGGCG GGGCGGGGTG CGGGTGCTGT GGTCAACGTG       420
     GTGGGCGCCG GCGGCAAGAG GGCCAATCCC GTGCATCTGG CCGGTGGCGC CGCCAATGCG       480
     GCGTTGATGC TGGCAGGCAC GGGCCTGGCC GCTGCATACG CACCGAGCGG AGTCCGCATC       540
     AACACCATCA ACCCCGGGCA AGTGCGCACG GAGCGGCTGC AGGCCCAGCG TGATGCCCAG       600
     GCGGCGGCTG GCGGCGCGCC GTTGGCGGAG CCGCCACTGG GGCGGCCCGC CGAGCCCGAG       660
     GAAATTGCCG CGCTCGCGGT GTTCCTTGCC TCTCCTCGCG CAAGCTACGT CAGCGGTGCC       720
     GTGATCGCCA TGGATGGCGT TGCGTTGCCC ACCGTGGTGT GA                          762
//

If you have problems or comments...

PBIL Back to PBIL home page