(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE84

ALDEN1_2.PE84        Location/Qualifiers
FT   CDS_pept        91601..92116
FT                   /locus_tag="Alide_0085"
FT                   /gene_family="HOG000071411" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /codon_start="1"
FT                   /product="carboxymuconolactone decarboxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   pol:Bpro_2144 carboxymuconolactone decarboxylase"
FT                   /db_xref="GI:319760822"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="GeneID:10102108"
FT                   /translation="MRIAPITPGTRPELAELEATITRQRGRVSPLYQVLLNSPAMAHGW
FT                   EQMLTAVRRHNSLPDLDRELLIVRVAVLNHARFEYEAHVPIALQAGASSQMIADVSGAD
FT                   AIGASVQGGLRALVELADAMTSRIDVPDALYAQAAAYYTQQQMVDAMVTIGAYNMVSRF
FT                   LEAVQIGH"
FT                   /protein_id="YP_004124759.1"
     ATGCGAATCG CACCCATAAC ACCCGGAACA CGTCCTGAAC TGGCCGAACT GGAAGCCACC        60
     ATCACCCGGC AGCGCGGCCG CGTTTCGCCG CTCTACCAGG TGCTGCTCAA TAGCCCGGCC       120
     ATGGCCCATG GCTGGGAGCA GATGCTTACG GCCGTGCGCC GGCACAACAG CTTGCCCGAC       180
     CTCGATCGCG AGTTGCTCAT CGTGCGGGTG GCCGTTCTGA ACCACGCGCG CTTCGAGTAC       240
     GAGGCGCATG TGCCCATCGC CCTGCAGGCC GGTGCCAGCA GCCAGATGAT TGCCGACGTC       300
     TCGGGCGCAG ACGCGATCGG CGCGTCCGTG CAGGGCGGCC TGCGCGCCCT GGTGGAACTG       360
     GCGGATGCGA TGACGTCGCG GATCGACGTG CCGGATGCGC TGTATGCGCA AGCGGCGGCG       420
     TACTACACGC AGCAGCAGAT GGTGGATGCC ATGGTGACGA TCGGCGCATA CAACATGGTG       480
     TCGCGGTTCC TGGAAGCCGT GCAGATCGGC CATTGA                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page