(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE85

ALDEN1_2.PE85        Location/Qualifiers
FT   CDS_pept        complement(92123..93409)
FT                   /locus_tag="Alide_0086"
FT                   /gene_family="HOG000038200" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /codon_start="1"
FT                   /product="uracil-xanthine permease"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0048 uracil-xanthine permease;
FT                   TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="GI:319760823"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="GeneID:10102109"
FT                   /translation="MGMFQWNERPAEVLQGGGVIGPDERLPWGQTGLMGIQHVIAMFGS
FT                   TVLAPILMGFDPNLAVFMSGIGTLIFFLVTGGKVPSYLGSSFAFIGVVIAATAYAGKGA
FT                   NANIGVALGGIIACGAVYAAVGVVVHLVGTGWIERFMPPVVTGAVVAVIGLNLAAIPIK
FT                   NMAASNFDSWMQALTFVCVALVAVFTRGMVQRLLILVGLILASIAYALFTNGMGLGKPV
FT                   DLSGVMAAPWFGVPQFHAPVFSAPAMLLIVPVVIILVAENLGHIKAVTAMTGKNLDQYM
FT                   GRAFIGDGVATMVSGVAGGTGVTTYAENIGVMAATRIYSTAVFLVAALIAVLLGFSPKF
FT                   GALIQAIPLPVMGGVSIVVFGLIAIAGAKIWVDNRVDFSQNKNLIVAAITLILGTGEFT
FT                   LKFGDFALGGIGTATFGAIVLYALLNRGR"
FT                   /protein_id="YP_004124760.1"
     atggggatgt ttcaatggaa tgagcgcccg gccgaggtgc tgcagggcgg cggcgtgatc        60
     gggccggacg agcgcctgcc ctgggggcag acgggcctga tggggattca gcacgtgatc       120
     gccatgttcg gctcgacggt gctcgcgccc atcctgatgg ggttcgaccc caacctcgcc       180
     gtgttcatga gcggcatagg cacgctcatc ttcttcctcg tcaccggcgg caaggtgccc       240
     agctacctgg gctcgtcgtt cgccttcatc ggcgtggtga tcgccgccac ggcctacgcg       300
     ggcaaggggg cgaatgccaa catcggcgtg gcgctgggcg gcatcatcgc ctgcggcgcg       360
     gtgtacgcgg ccgtcggcgt ggtggtgcac ctggtcggca ccggctggat cgagcgcttc       420
     atgccgcccg tggtgacggg cgcggtggtg gccgtcatcg gcctgaacct ggccgcgatc       480
     ccgatcaaga acatggcggc cagcaacttc gacagctgga tgcaggccct gaccttcgtc       540
     tgcgtggcgc tagtggccgt gttcacgcgc ggcatggtgc agcgcctgtt gatcctcgtg       600
     gggctgatcc tggcgagcat cgcctacgcc ctgttcacca acggcatggg cctgggcaag       660
     cccgtggatc tgtcgggcgt gatggccgcg ccctggttcg gcgtgccgca gttccacgcg       720
     ccggtgttca gcgcgccggc catgctgctc atcgtgcccg tggtcatcat cctggtggcc       780
     gagaacctgg gccacatcaa ggccgtgacg gccatgaccg gcaagaacct ggaccaatac       840
     atgggccgcg ccttcatcgg cgacggcgtg gccaccatgg tcagcggcgt ggccggcggc       900
     acgggcgtga cgacctacgc cgaaaacatt ggcgtgatgg ctgccacgcg catctactcc       960
     acggccgtgt tcctggtggc ggcgctgatc gccgtgctgc tgggcttctc gccgaagttc      1020
     ggcgcgctga tccaggccat tccgctgccg gtgatgggtg gcgtgtccat agtggttttc      1080
     ggcctgatcg ccatcgcggg cgccaagatc tgggtggaca accgggtgga cttctcgcag      1140
     aacaagaacc tgatcgtggc cgccatcacg ctcatcttgg gcacgggcga gttcacgctc      1200
     aagttcggcg acttcgccct gggcggcatc ggcacggcca ccttcggcgc catcgtgctg      1260
     tatgcgctgc tgaaccgcgg gcgctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page