(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE86

ALDEN1_2.PE86        Location/Qualifiers
FT   CDS_pept        93561..94271
FT                   /locus_tag="Alide_0087"
FT                   /gene_family="HOG000042551" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /codon_start="1"
FT                   /product="methyltransferase fkbm family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   sna:Snas_6312 methyltransferase FkbM family"
FT                   /db_xref="GI:319760824"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="GeneID:10102110"
FT                   /translation="MKALIKALAHRAGLDVMSLAYSRDYIYDRFLPGALKGHGIQAVID
FT                   IGANIGGYGELLRRVGFAGDIHSFEPCSQPFGELARKAAGDPRWHVYQKAASDRSGTAQ
FT                   IHTMVGSELNSFLSLRESSRKMTETGTEDVETVTLDGLDLPIDWSRTFVKIDTQGHDVK
FT                   VMSGGRNVLRQAALIQSEVSFLPIYQGMPAFDEAIASLKELGFDVIGMFPVSRDSLGRV
FT                   QEFDCLCVNRNLPR"
FT                   /protein_id="YP_004124761.1"
     ATGAAAGCCC TGATCAAAGC CTTGGCGCAT CGCGCCGGCC TTGATGTGAT GTCCCTCGCC        60
     TACAGCCGGG ATTACATCTA CGACCGTTTT CTCCCTGGCG CCCTGAAAGG GCACGGGATA       120
     CAGGCCGTGA TCGACATAGG CGCCAATATC GGCGGTTACG GCGAGTTGCT GCGCAGGGTG       180
     GGGTTTGCCG GGGACATTCA TTCCTTCGAA CCCTGTTCGC AGCCATTCGG CGAGTTGGCG       240
     CGCAAGGCTG CCGGCGACCC GCGCTGGCAT GTTTACCAGA AGGCGGCCAG CGACCGGTCC       300
     GGCACCGCGC AGATCCACAC CATGGTGGGC AGCGAGCTGA ACTCCTTTCT GTCCCTCCGG       360
     GAGTCCAGCC GCAAGATGAC CGAGACCGGT ACGGAGGACG TCGAGACGGT CACGCTCGAC       420
     GGGCTGGACC TGCCGATAGA CTGGTCCCGT ACCTTCGTGA AGATCGACAC CCAGGGCCAC       480
     GACGTCAAGG TGATGTCGGG CGGCCGGAAC GTGCTGCGCC AGGCGGCGCT CATTCAGTCG       540
     GAGGTTTCGT TCCTGCCCAT CTACCAGGGC ATGCCGGCGT TCGACGAGGC CATTGCCAGC       600
     CTGAAGGAGC TGGGTTTCGA CGTCATAGGC ATGTTCCCCG TGTCGCGCGA CTCCCTGGGC       660
     CGTGTCCAGG AGTTCGACTG CCTGTGCGTC AACCGCAACC TGCCCCGCTG A                711
//

If you have problems or comments...

PBIL Back to PBIL home page