(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE87

ALDEN1_2.PE87        Location/Qualifiers
FT   CDS_pept        complement(94398..95666)
FT                   /locus_tag="Alide_0088"
FT                   /gene_family="HOG000255771" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01988"
FT                   /codon_start="1"
FT                   /product="ubiquinone biosynthesis hydroxylase,
FT                   ubih/ubif/visc/coq6 family"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0052 hypothetical protein; TIGRFAM:
FT                   Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6
FT                   family; PFAM: monooxygenase FAD-binding"
FT                   /db_xref="GI:319760825"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="GeneID:10102111"
FT                   /translation="MPPQQTNTHSSSDVLIVGAGPAGLSLAASLAQAGMQVTVLEQQPA
FT                   SVLAAPPPDGREIALTHPSVATLQRLGSWQRLAAHEVGLLREAQVHDGPVGRRGAMQLH
FT                   AGGSGVDHLGWIVPNYALRRTAYEVAAQQPDVRIVTEARVARVAVTPAHAELEYTDARQ
FT                   GGQGAERLQAPLLVAADSRFSATRRQLGIGAAMHDFGRTVIVCRLRHELPHHEVAHECF
FT                   GYEQTLAILPLPNDPIDGAPMCSAVVTTGAAQAQQLMALPPEEYAARVQAQFQNRLGAM
FT                   RLVGERHAYPLVAVYAHRFAGPRCALLGDAAVGMHPVTAHGYNLGLAGVEGLTRAVAGA
FT                   WARGADIGAASVLAPYAREHHRHAWPLYQGTNAIVRLYTDDRPLPRLLRQAVLAGSNRL
FT                   PPLKGLIVSQLTGRRPAWPTAAP"
FT                   /protein_id="YP_004124762.1"
     atgccaccgc aacagacgaa tacccacagc agcagtgatg tcctcatcgt cggcgccggc        60
     ccggccgggc tgtcgctggc ggcctcgctg gcgcaggccg gcatgcaggt cacggtgctg       120
     gagcagcagc ccgcgtccgt gctcgccgcc ccgccgcccg acgggcgcga gatcgccctc       180
     acccacccca gcgtggccac gctgcagcgc ctgggcagct ggcagcgcct ggccgcgcac       240
     gaggtcggcc tgctgcgcga ggcccaggtg cacgacggcc ccgtgggccg gcgcggcgcc       300
     atgcagctgc acgcgggagg cagcggcgtg gaccacctgg gctggatcgt gcccaattac       360
     gcgctgcgcc gcacggccta cgaggtcgcg gcccagcagc cggacgtgcg catcgtgacc       420
     gaggcgcgcg tcgcgcgcgt ggccgtcacg cccgcccatg ccgagctcga atacaccgac       480
     gcgcgccagg gcggccaggg cgcggagcgc ctgcaggccc cgctgctggt ggcggccgac       540
     agccgctttt ccgccacgcg gcgccagctg ggcataggcg cggccatgca cgacttcggc       600
     cgcaccgtca tcgtctgccg cctgcgccac gagctgccgc accatgaggt cgcacacgaa       660
     tgcttcggct acgagcagac gctggccata ctgccgctgc cgaacgaccc catcgacggc       720
     gcgcccatgt gctcggccgt ggtcacgacc ggcgctgcgc aggcccagca gctcatggcc       780
     ctgccgcccg aggaatacgc cgcgcgcgtg caggcgcagt tccagaaccg cctgggcgcc       840
     atgcgcctcg tgggcgagcg ccacgcctac cccctggtgg ccgtgtacgc ccaccgcttc       900
     gccggcccgc gctgcgcgct gctgggcgac gccgccgtgg gcatgcaccc ggtgacggcg       960
     catggctaca acctgggcct ggcgggcgtg gagggcctca cgcgggccgt ggccggagca      1020
     tgggcgcgcg gcgcggacat aggcgccgcc agcgtgctcg ccccctacgc gcgcgaacac      1080
     caccgtcacg cctggccgct gtaccagggc acgaacgcca tcgtgcgcct gtacaccgac      1140
     gaccgccccc tgccgcgcct gctgcgccag gccgtgctgg ccggctccaa ccggctgcct      1200
     ccgctcaagg gcctgatcgt cagccagctc acggggcggc ggccggcctg gccgacggcg      1260
     gcgccgtga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page