(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE89

ALDEN1_2.PE89        Location/Qualifiers
FT   CDS_pept        complement(97943..98872)
FT                   /locus_tag="Alide_0090"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ajs:Ajs_0055 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760827"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102113"
FT                   /translation="MNLRQLSQFVTLAETGNFHRAAERLHMAQPPLSVSIRKLEEELGS
FT                   ALFARTRTGVALTPAGQAMLDDARRTLLHAQQCRQAVLDTREGTGGRLRLGIIGSATYA
FT                   LLPRLIPSLRARYPQITLELSEATSSEILEGLVSRRFDAGLLRFPLLDASGFDLTPLDR
FT                   DDFVLAVAETSPLARREAIALHEAAHEPFIMYPRSKVPGLLALAMMRCQFSGFAPQVAQ
FT                   EAAQVQTIMSLVASGLGVGLVAGVARQVVPRGVKCLRLTDNPPGFHVSIALARLAGNTS
FT                   RVVQRFAEHALECAGAPHVEGGGGGGPG"
FT                   /protein_id="YP_004124764.1"
     atgaacctgc gacagctgag ccagttcgtc acgctggcgg agacgggcaa ctttcaccgc        60
     gcggccgagc ggctgcacat ggcgcagccg ccgctgtcgg tctccatccg caagctggag       120
     gaagagctgg gcagcgcgct gttcgcgcgc acgcgcacgg gcgtcgcgct cacccccgcg       180
     ggccaggcca tgctggacga cgcgcgccgc acgctgctgc acgcccagca atgccgccag       240
     gcggtgctgg acacgcgcga gggcacgggc gggcggctgc gcctgggcat catcggctcg       300
     gccacctatg cgctgctgcc gcggctcatc ccatcgctgc gcgcgcgcta cccgcagata       360
     acgctggagc tgtccgaggc cacctcgtcc gagatcctgg agggcctggt ctcgcgccgc       420
     ttcgatgccg gcctgctgcg ctttcccctg ctcgacgcca gcggcttcga cctgacgccg       480
     ctggaccgcg acgacttcgt gctggccgtg gcagagacca gcccgctggc ccggcgcgag       540
     gccatcgccc tgcacgaggc cgcgcacgag cccttcatca tgtacccgcg cagcaaggtg       600
     cccggcctgc tggccctggc catgatgcgc tgccagttct ctggcttcgc gccgcaggtg       660
     gcgcaggagg ccgcgcaggt acagaccatc atgagcctgg tggcctcggg cctgggcgtg       720
     ggcctggtgg ccggcgtggc gcgccaggtg gtgccgcgcg gcgtgaaatg cctgcggctg       780
     accgacaacc cgccgggctt tcacgtcagc atcgcgctgg ccaggctggc gggcaacacc       840
     agccgcgtag tgcagcgctt tgccgagcat gcgctggaat gcgccggagc gccgcacgtg       900
     gagggcgggg gtgggggcgg accgggctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page