(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE9

ALDEN1_2.PE9         Location/Qualifiers
FT   CDS_pept        complement(10084..11856)
FT                   /locus_tag="Alide_0009"
FT                   /gene_family="HOG000258966" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   reh:H16_A2141 hypothetical protein"
FT                   /db_xref="GI:319760747"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="GeneID:10102032"
FT                   /translation="MNQTVLIGGASGFWGDSQIAVPQLLRQPGLQYLVFDYLAETTMSI
FT                   LQRARLRAPELGYATDFVTAAVGPHLREIKAKGVRLVSNAGGLNPAGCRDAILALAREQ
FT                   GVDLKVAIVTGDDVLDLQPRFEPWGDEATADLPALMSANAYLGAAPVAQALAAGADIVV
FT                   TGRCVDSASLLGIAIHEFGWRMTDYDRLAQASLAGHLVECGAQATGGLFTDWEQVPDWA
FT                   DIGYPLVRLQADGSFELSQPEGAGGLVTRQTVGEQLLYEIGDPAAYELPDVVCDFTQVA
FT                   ITDLDGGRVRVQGARGRAPGGRYKVTATYQQGWHIAIMMAIRGQRALAKAQRTADALLA
FT                   RTRRQMQAAGFADYEDTLVELLGAESMYGPHRRVADSREIVLRIAARHRDRRALAFLQK
FT                   EASSAGTSMGPGTRSHFGGRSDVQSIIRTASFLLPKAAVAVQVQAAPDEAPAAVEAADA
FT                   AAAPAAPNPPEATAAGAAASGPTVRIALGRIAHGRSGDKGDDANIGLMARDPKWLPVLR
FT                   GQLTAERVLQYFAHLVQGPVQRYELPGLGAFNFVLRRALGGGGSCSLRSDPLGKCYAQM
FT                   LLDMEIDCPEDLAP"
FT                   /protein_id="YP_004124684.1"
     atgaatcaaa ccgttctgat cggaggcgcc tccggcttct ggggcgactc gcagatcgcc        60
     gtgccgcagc tgctgcgcca gcccgggctg cagtacctgg tgttcgacta cctggccgag       120
     accaccatgt ccatcctgca gcgcgcccgg ctgcgcgcgc cggagctggg ctacgcgacg       180
     gacttcgtca ccgccgccgt cggcccgcac ctgcgcgaga tcaaggccaa gggcgtgcgc       240
     ctggtctcca acgccggcgg cctgaacccc gcgggctgcc gcgacgccat cctggcgctg       300
     gcgcgcgagc agggcgtgga cctgaaggtg gccatcgtca ccggcgacga cgtgctggac       360
     ctgcagcccc ggttcgagcc ctggggcgac gaggccacgg cggacctgcc cgcattgatg       420
     tcggccaacg cctacctggg cgcggcgccc gtcgcgcagg cgctggctgc gggcgccgac       480
     atcgtggtca cgggccgctg cgtggacagc gcctcgctgc tgggcatcgc catccatgag       540
     ttcggctggc gcatgacgga ctacgaccgg ctcgcccagg ccagcctcgc gggccatctg       600
     gtggaatgcg gcgcgcaggc cacgggcggc ctgttcaccg actgggagca ggtgcccgac       660
     tgggccgaca tcggctaccc gctggtgcgg ctgcaggccg acggcagctt cgagctgtcg       720
     cagcccgagg gcgcgggcgg gctggtcacg cggcagacgg tgggcgagca gctgctgtac       780
     gagatcggcg accccgcggc ctacgagctg cccgacgtgg tgtgcgactt cacgcaggtc       840
     gcgatcaccg acctggacgg agggcgcgta cgcgtgcagg gtgcgcgcgg ccgcgcgccc       900
     ggcggccgct acaaggtcac ggccacctac cagcagggct ggcacatcgc catcatgatg       960
     gccatccgcg gccagcgcgc gctggccaag gcgcagcgca cggccgacgc gctgctggca      1020
     cgcacgcgcc ggcagatgca ggcggcgggc ttcgccgact acgaggacac cctggtcgag      1080
     ctgctgggcg ccgaatccat gtacggaccg caccggcgcg tggccgacag ccgcgagatc      1140
     gtgctgcgca tcgccgcccg gcaccgcgat aggcgcgcgc tggccttcct gcagaaagag      1200
     gcctcttccg ccggcacctc gatggggccg ggcacgcgca gccatttcgg cggccgctcc      1260
     gacgtgcaga gcatcatccg caccgcctcg ttcctgctgc ccaaggcggc ggttgcggtg      1320
     caggtgcagg ccgcgccgga cgaagcgccg gcggcggtcg aagcggccga tgccgcggcg      1380
     gcgccggccg cgcccaatcc gcccgaggcc acggccgcag gcgccgctgc cagcggcccc      1440
     acggtgcgca tcgcgctggg ccgcatcgca cacggccgca gcggcgacaa gggcgacgac      1500
     gccaacatcg gcctgatggc ccgcgatccg aaatggctgc cggtgctgcg cgggcagctc      1560
     accgccgagc gggtgcttca gtacttcgcc cacctggtgc aggggccggt gcagcgctac      1620
     gagctgccgg gcctgggcgc cttcaacttc gtgctgcgcc gcgcgctggg cggcggcggc      1680
     tcgtgcagcc tgcgctcgga cccgctgggc aagtgctacg cgcagatgct gctggacatg      1740
     gagatcgatt gccccgaaga cctggcgccc tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page