(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE92

ALDEN1_2.PE92        Location/Qualifiers
FT   CDS_pept        101177..102202
FT                   /locus_tag="Alide_0093"
FT                   /gene_family="HOG000131664" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0062 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760830"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="GeneID:10102116"
FT                   /translation="MDNDLFADAARQVLADQCTPAVVRAIEAGGRAAPEAAALWAQLEA
FT                   TGLADALLPESQGGAGLALSQVFGVLEQCGAHALPLPLGETMVARALLAAAGVDRPAGG
FT                   IALARGERTPEGGLRCALVRGGRVAHAVLAQAGDAWHLLGVAGAQEAPQALALDAALAW
FT                   TPAQLQAAPAVAVDAALDLRTLQAAVLAPQMAGAAMHVFQRTLQYANERQQFGRPIGKF
FT                   QAIQHQLAVMSEHVFAARMAAQLGCSGAGVRPDRLRVATAKARCSEAALAVSEFAHSIH
FT                   GAIGFTAEYDLQLFTRRLHAWRQAAGSESYWHDVAGQALLEHQGLTLDVVRRITDVESV
FT                   L"
FT                   /protein_id="YP_004124767.1"
     ATGGACAACG ATCTGTTTGC CGACGCGGCC CGCCAGGTGC TGGCCGATCA ATGCACGCCT        60
     GCGGTGGTGC GCGCCATCGA GGCCGGCGGC CGCGCCGCGC CCGAGGCCGC CGCGCTCTGG       120
     GCGCAGCTGG AGGCCACGGG CCTGGCCGAC GCGCTGCTGC CCGAAAGCCA GGGCGGCGCG       180
     GGCCTTGCGC TGTCGCAGGT CTTCGGCGTG CTGGAGCAAT GCGGCGCGCA CGCGCTGCCG       240
     CTGCCGCTGG GCGAGACCAT GGTGGCGCGC GCGCTGCTTG CGGCCGCCGG CGTGGACCGG       300
     CCCGCGGGCG GCATCGCGCT GGCGCGCGGC GAGCGCACGC CGGAGGGCGG CCTGCGCTGC       360
     GCCCTGGTGC GCGGCGGCCG CGTGGCGCAT GCGGTGCTGG CGCAGGCCGG CGACGCCTGG       420
     CACCTGCTGG GCGTGGCCGG CGCGCAGGAG GCGCCCCAGG CGCTGGCGCT CGATGCCGCG       480
     CTGGCCTGGA CGCCCGCGCA GCTGCAGGCC GCGCCCGCGG TGGCCGTGGA TGCCGCGCTC       540
     GACCTGCGCA CCCTGCAGGC CGCCGTGCTC GCGCCGCAGA TGGCCGGCGC GGCGATGCAC       600
     GTCTTCCAGC GCACGCTGCA ATACGCCAAC GAGCGCCAGC AGTTCGGCCG CCCCATCGGC       660
     AAGTTCCAGG CCATACAGCA CCAGCTGGCC GTGATGAGTG AGCATGTGTT CGCCGCGCGC       720
     ATGGCCGCGC AGCTGGGCTG CAGCGGCGCC GGCGTGCGGC CCGACCGCCT GCGCGTGGCG       780
     ACGGCCAAGG CGCGCTGCAG CGAGGCGGCG CTGGCCGTGT CCGAGTTCGC CCACTCCATC       840
     CACGGCGCCA TCGGCTTCAC CGCCGAATAC GACCTGCAGC TGTTCACGCG CCGCCTGCAC       900
     GCCTGGCGCC AGGCCGCGGG CAGCGAGTCC TACTGGCACG ACGTGGCCGG CCAGGCGCTG       960
     CTGGAGCACC AGGGGCTGAC GCTGGACGTG GTGCGCCGCA TCACCGACGT GGAAAGCGTG      1020
     CTTTGA                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page