(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE93

ALDEN1_2.PE93        Location/Qualifiers
FT   CDS_pept        102308..103096
FT                   /locus_tag="Alide_0094"
FT                   /gene_family="HOG000027949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ajs:Ajs_0063 enoyl-CoA hydratase"
FT                   /db_xref="GI:319760831"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102117"
FT                   /translation="MAFLTLERDGAILTVTMNQPETRNALTGNTAVQEFVQLCDDVRKD
FT                   AGVKVIILTGAGPIFSSGGNVKDMKRFFDDALTPDLIREEYRQGIQRIPQALYNLDVPV
FT                   ICAVNGPAIGAGLDLTCMCDIRIAAETATFAESFVRVGIVPGDGGAWLLPRAVGMAKAA
FT                   EMAFTGEAINAQEALACGLVSRVVPAGELLPTARALADKIAANPGAVMRMTKRLLREGQ
FT                   LATLDSLLELSAGCQAIAHKTADHREAVTAFIEKRAPRFQ"
FT                   /protein_id="YP_004124768.1"
     ATGGCCTTCC TGACTCTAGA GCGCGACGGC GCCATCCTGA CCGTCACCAT GAACCAGCCC        60
     GAGACGCGCA ACGCCCTCAC CGGCAACACG GCGGTGCAGG AATTCGTGCA GCTGTGCGAC       120
     GACGTGCGCA AGGACGCGGG CGTGAAGGTG ATCATCCTCA CCGGCGCCGG CCCCATCTTC       180
     AGCTCGGGCG GCAACGTCAA GGACATGAAG CGCTTCTTCG ACGACGCGCT CACGCCCGAC       240
     CTGATCCGCG AGGAATACCG CCAGGGCATA CAGCGCATCC CGCAGGCGCT GTACAACCTG       300
     GACGTGCCGG TGATCTGCGC CGTCAACGGC CCGGCCATCG GCGCGGGGCT GGACCTGACC       360
     TGCATGTGCG ACATCCGCAT CGCGGCGGAG ACGGCCACCT TCGCCGAGAG CTTCGTGCGC       420
     GTGGGCATCG TCCCCGGCGA CGGCGGCGCC TGGCTGCTGC CGCGCGCCGT GGGCATGGCC       480
     AAGGCGGCCG AGATGGCCTT CACCGGCGAG GCCATCAATG CACAGGAAGC GCTGGCCTGC       540
     GGCCTCGTGA GCCGCGTGGT GCCCGCCGGC GAGCTGCTGC CCACGGCCCG CGCCCTGGCC       600
     GACAAGATCG CCGCCAACCC CGGCGCCGTG ATGCGCATGA CCAAGCGCCT GCTGCGCGAG       660
     GGCCAGCTCG CCACGCTCGA CTCGCTGCTG GAACTGTCGG CCGGCTGCCA AGCCATCGCC       720
     CACAAGACGG CCGACCACCG CGAGGCCGTC ACCGCCTTCA TCGAAAAGCG CGCGCCGCGC       780
     TTTCAGTGA                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page