(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE94

ALDEN1_2.PE94        Location/Qualifiers
FT   CDS_pept        103126..103749
FT                   /locus_tag="Alide_0095"
FT                   /gene_family="HOG000229371" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /codon_start="1"
FT                   /product="cdp-diacylglycerol/serine
FT                   o-phosphatidyltransferase"
FT                   /transl_table="11"
FT                   /note="manually curated; TIGRFAM: CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase; KEGG: dia:Dtpsy_0083
FT                   CDP-diacylglycerol/serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="GI:319760832"
FT                   /db_xref="GO:0003882"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="GeneID:10102118"
FT                   /translation="MASPHKRFSMIREFHLADWFTLGNAVCGVGALFSSMTYLETADLR
FT                   HVYFACALVLAALVFDVLDGRIARWRQKSSAMGRELDSLADVISFGVAPAIIAYACGMQ
FT                   GLYDRIVLAFFVACGVSRLARFNITAETLAEGPSGKVRYFEGTPIPTSIVLVGLLALAA
FT                   STGAVREHLWLGKMMIGGFTLHPLVLLFALSGSLMISRIRIPKL"
FT                   /protein_id="YP_004124769.1"
     ATGGCTTCTC CCCACAAACG CTTCTCGATG ATCCGCGAGT TCCACCTCGC GGACTGGTTC        60
     ACGCTGGGCA ACGCGGTGTG CGGCGTGGGG GCGTTGTTCT CCAGCATGAC CTACCTGGAA       120
     ACGGCGGACC TGCGCCACGT CTACTTCGCC TGCGCGCTGG TGCTCGCGGC GCTGGTGTTC       180
     GACGTGCTGG ACGGGCGCAT CGCGCGCTGG CGGCAGAAGA GCTCGGCCAT GGGGCGCGAG       240
     CTCGACTCGC TGGCCGACGT GATCTCCTTC GGCGTGGCGC CGGCCATCAT CGCCTACGCC       300
     TGCGGCATGC AAGGACTGTA CGACCGCATC GTGCTCGCCT TCTTCGTGGC CTGCGGCGTC       360
     TCGCGCCTGG CGCGCTTCAA CATCACGGCC GAGACCCTGG CCGAAGGCCC CTCGGGCAAG       420
     GTCAGGTACT TCGAGGGCAC GCCCATCCCC ACCTCCATCG TGCTCGTGGG CCTGCTCGCG       480
     CTGGCCGCGT CCACGGGCGC GGTGCGCGAG CACCTGTGGC TGGGCAAGAT GATGATCGGC       540
     GGCTTCACGC TGCACCCGCT GGTGCTGCTG TTCGCGCTGT CGGGCTCGCT GATGATCAGC       600
     CGCATCCGCA TCCCCAAGCT GTAA                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page