(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE95

ALDEN1_2.PE95        Location/Qualifiers
FT   CDS_pept        103858..106059
FT                   /locus_tag="Alide_0096"
FT                   /gene_family="HOG000262302" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /codon_start="1"
FT                   /product="tonb-dependent siderophore receptor"
FT                   /transl_table="11"
FT                   /note="manually curated; TIGRFAM: TonB-dependent
FT                   siderophore receptor; KEGG: neu:NE2433 TonB-dependent
FT                   receptor protein; PFAM: TonB-dependent receptor;
FT                   TonB-dependent receptor plug"
FT                   /db_xref="GI:319760833"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0015343"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="GeneID:10102119"
FT                   /translation="MPHCTPSRASSAPAPVLGACAVAIQVMLGSASLSGAVPAAAQSAG
FT                   GGTAAALPEVTVTQRREAIDEAPPAYAGGQVGSGARLGILGNAPVLDTPFSVTSYTAQA
FT                   IENEQARSVADVIAMDPSVRMASARSNINEDITIRGFAVPSGDFALNGMFGLTPYWRAP
FT                   LEAVERVEVLKGPSAALFGMAPGGSVGGVVNLVSKRAGAQPLTRFTAGVMSDSVAGGHL
FT                   DVGRRFGPDGALGARVNLMRRQGDTNIDHQSTRESLASLGLDLRQSALRASLDLLWQEQ
FT                   RIDNVVRQFQLAPGLAAIPRAPDNSIAYPGYGWTDGHDGSALFKAEYDINDTLTAYAGL
FT                   GQRKLNWGSMAGNPVILNTAGDYSYFGGWQRMGVDSKSAEAGVRASFRTGGMAHNAALA
FT                   FTRLDQDQTLGFYTGFPGGMSNLYAGGRQPTPSIAGIDNPLRPYQDSKLTSVALADTVT
FT                   LLEDRLLVTLGLRHQKVQGQSYNYMTGAASGPYYDKSATTPLAGVVFKLRPNWSLYASY
FT                   VEGLSRGETAPVSAAIANPGEAMPPYRSKQKEIGAKFDHGGFLATVGLFELTRPSAAVS
FT                   GNVFGVNGEQRNRGLEASVAGEVARGLRLLGGASFMDAELSRSANAALVGKRAIGVPRS
FT                   QLNLGAEWDAGFAPGLTLTGRMVHTAKTYADAANTLRVAGWTRWDAGARYATRIGGKPV
FT                   TFRLNVENLLDKNYYGIATAGYLFLGSPRTVSLSASVDL"
FT                   /protein_id="YP_004124770.1"
     ATGCCGCACT GCACGCCATC CCGGGCTTCG TCCGCCCCTG CCCCTGTTCT TGGCGCTTGC        60
     GCCGTTGCCA TCCAGGTCAT GCTGGGGAGC GCCAGCCTGT CCGGGGCGGT GCCTGCCGCC       120
     GCGCAGTCCG CCGGCGGCGG CACCGCCGCG GCGCTGCCCG AGGTCACGGT GACCCAGCGC       180
     CGCGAGGCCA TCGACGAGGC GCCGCCGGCC TACGCCGGGG GCCAGGTCGG CAGCGGCGCA       240
     CGCCTGGGCA TCCTCGGCAA CGCCCCGGTG CTGGACACGC CGTTCAGCGT GACCAGCTAC       300
     ACGGCGCAGG CGATCGAGAA CGAGCAGGCG CGCTCCGTGG CCGACGTGAT CGCGATGGAC       360
     CCCTCGGTGC GCATGGCCAG CGCGCGCTCG AACATCAACG AGGACATCAC CATCCGCGGC       420
     TTCGCGGTGC CCAGCGGCGA CTTCGCGCTC AACGGCATGT TCGGGCTCAC GCCGTACTGG       480
     CGCGCGCCGC TGGAGGCGGT GGAGCGCGTC GAGGTGCTCA AGGGGCCGTC CGCGGCGCTG       540
     TTCGGCATGG CGCCGGGCGG CAGTGTGGGC GGCGTGGTCA ACCTCGTATC CAAGCGGGCC       600
     GGCGCCCAGC CCCTCACCCG CTTCACGGCC GGCGTGATGT CGGACTCGGT GGCGGGCGGG       660
     CACCTGGACG TCGGCCGGCG CTTCGGCCCG GACGGCGCGC TCGGCGCGCG CGTCAACCTC       720
     ATGCGCCGCC AGGGCGACAC GAACATCGAC CACCAGTCCA CGCGCGAATC GCTCGCCTCG       780
     CTGGGGCTGG ACCTGCGCCA GAGTGCGCTG CGCGCCTCGC TCGACCTGCT GTGGCAGGAG       840
     CAGCGCATCG ACAACGTGGT GCGCCAGTTC CAGCTCGCGC CGGGCCTGGC GGCCATCCCG       900
     CGCGCGCCGG ACAACTCCAT CGCCTACCCG GGCTACGGCT GGACGGACGG CCATGACGGC       960
     TCGGCCCTCT TCAAGGCCGA ATACGACATC AACGACACCC TGACGGCCTA CGCGGGCCTG      1020
     GGCCAGCGCA AGCTGAACTG GGGCTCCATG GCGGGCAACC CCGTCATCCT GAACACCGCG      1080
     GGCGACTATT CGTACTTCGG CGGCTGGCAG CGCATGGGCG TCGACTCCAA GTCGGCCGAG      1140
     GCGGGCGTGC GTGCCAGCTT CAGGACGGGG GGCATGGCCC ACAACGCCGC GCTGGCGTTC      1200
     ACGCGCCTCG ACCAGGACCA GACCCTGGGC TTCTACACGG GCTTCCCGGG CGGCATGTCC      1260
     AACCTCTACG CGGGCGGGCG GCAGCCCACG CCGTCCATCG CCGGCATCGA CAATCCCCTG      1320
     CGCCCGTACC AGGACAGCAA GCTCACCAGC GTCGCGCTGG CCGACACCGT GACGCTGCTC      1380
     GAAGACCGGC TGCTCGTGAC CCTGGGCCTG CGCCACCAGA AGGTGCAGGG CCAGAGCTAC      1440
     AACTACATGA CCGGCGCGGC GAGCGGCCCC TACTACGACA AGAGCGCCAC CACGCCGCTG      1500
     GCGGGCGTGG TGTTCAAGCT GCGGCCGAAC TGGTCGCTGT ACGCGAGCTA TGTCGAGGGC      1560
     CTGTCGCGCG GCGAGACCGC GCCCGTGAGC GCGGCCATCG CCAATCCGGG CGAGGCGATG      1620
     CCGCCGTACC GCTCCAAGCA GAAGGAGATC GGCGCGAAGT TCGACCACGG CGGCTTCCTC      1680
     GCGACGGTGG GCCTGTTCGA GCTGACCAGG CCCAGTGCGG CCGTCTCGGG CAACGTGTTC      1740
     GGCGTCAACG GCGAGCAGCG CAACCGGGGC CTGGAGGCCA GCGTCGCGGG CGAGGTCGCG      1800
     CGCGGCCTGC GTCTGCTGGG CGGCGCGTCC TTCATGGACG CCGAGCTCAG CCGGTCGGCC      1860
     AACGCCGCCC TCGTGGGCAA GCGGGCCATC GGCGTGCCCA GGTCGCAGCT CAACCTGGGC      1920
     GCCGAGTGGG ACGCGGGCTT CGCGCCGGGG CTCACGCTCA CGGGCCGCAT GGTCCATACC      1980
     GCCAAGACCT ACGCGGACGC CGCCAACACG CTGCGGGTCG CGGGCTGGAC GCGCTGGGAC      2040
     GCCGGCGCGC GCTACGCCAC CCGCATCGGC GGCAAGCCGG TCACCTTCCG CCTCAACGTC      2100
     GAGAACCTGC TCGACAAGAA CTACTACGGC ATCGCCACGG CGGGCTACCT GTTCCTCGGC      2160
     AGCCCGCGCA CCGTGTCGCT GTCGGCCAGC GTGGACCTGT GA                         2202
//

If you have problems or comments...

PBIL Back to PBIL home page