(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE98

ALDEN1_2.PE98        Location/Qualifiers
FT   CDS_pept        107604..108365
FT                   /locus_tag="Alide_0099"
FT                   /gene_family="HOG000062060" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01222"
FT                   /codon_start="1"
FT                   /product="septum site-determining protein minc"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0084 septum site-determining protein
FT                   MinC; TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC"
FT                   /db_xref="GI:319760836"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="GeneID:10102122"
FT                   /translation="MAVDTAGQARTYLDLKSAQLSVVALVLKTADVSAVAAELAARRAD
FT                   DPEFFDNDPVLIDLSAVQGEAQPIDFAALVQALRSHRTQPVAVRGGSPAQMAAAHAAGL
FT                   IAAPDVPAARAQPRESGAVREVVREVVREVQVEVPVQAPAPGALVVDKPLRSGQQVYAR
FT                   GSDLVVMAVVSFGAEVIADGNIHVYAPLRGRAIAGARGDTSARIFTTCLEPQLVSVAGI
FT                   YRTTETELPDNVRGKPAQVRLDGEKLLIEPL"
FT                   /protein_id="YP_004124773.1"
     ATGGCCGTTG ACACGGCGGG CCAGGCCCGC ACCTATCTAG ACCTCAAGAG CGCCCAGCTG        60
     TCCGTGGTGG CCCTGGTGCT CAAGACTGCC GACGTTTCCG CCGTCGCCGC GGAACTGGCC       120
     GCCCGCAGGG CCGACGACCC CGAGTTCTTC GACAACGATC CGGTGCTGAT CGACCTGTCG       180
     GCCGTGCAGG GTGAGGCGCA GCCCATCGAC TTCGCCGCGC TGGTGCAGGC GCTGCGCAGC       240
     CACCGCACCC AGCCCGTGGC CGTGCGCGGC GGCAGTCCCG CGCAGATGGC CGCCGCCCAT       300
     GCCGCCGGCC TGATCGCCGC GCCCGACGTG CCCGCGGCGC GCGCGCAGCC GCGCGAGAGC       360
     GGCGCCGTGC GCGAGGTGGT CCGCGAGGTC GTGCGCGAAG TGCAGGTGGA AGTGCCCGTG       420
     CAGGCGCCGG CGCCCGGCGC GCTGGTGGTT GACAAGCCGC TGCGTTCGGG CCAGCAGGTC       480
     TACGCGCGTG GCTCCGACCT GGTCGTGATG GCCGTGGTCA GCTTCGGCGC CGAGGTGATC       540
     GCCGACGGCA ACATCCACGT CTATGCGCCG CTGCGCGGAC GCGCCATCGC CGGCGCGCGC       600
     GGCGACACCA GCGCCCGCAT CTTCACCACC TGCCTGGAGC CGCAGCTGGT CTCCGTGGCA       660
     GGCATCTACC GCACCACCGA GACCGAGCTG CCCGACAACG TGCGCGGCAA GCCGGCCCAG       720
     GTGCGGCTGG ACGGCGAAAA GCTGCTCATC GAGCCGCTGT AA                          762
//

If you have problems or comments...

PBIL Back to PBIL home page