(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1

ID   ALIAD_1; SV 1; empty ; DNA; empty ; PRO; 3018755 BP.
XX
AC   NC_013205;
XX
PR   Project: 59199;
XX
DE   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446, complete
DE   genome.
XX
OS   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
OC   Bacteria; Firmicutes; Bacillales; Alicyclobacillaceae; Alicyclobacillus.
XX
RN   [1]
RP   1-3018755
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Ovchinnikova,G., Chertkov,O., Sims,D., Brettin,T., Detter,J.C., Han,C.,
RA   Larimer,F., Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P.,
RA   Woyke,T., Wu,D., Pukall,R., Klenk,H.-P. and Eisen,J.A.;
RT   "The complete chromosome of Alicyclobacillus acidocaldarius subsp.
RT   acidocaldarius DSM 446";
RL   Unpublished
XX
RN   [2]
RP   1-3018755
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-SEP-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3018755
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Ovchinnikova,G., Chertkov,O., Sims,D., Brettin,T., Detter,J.C., Han,C.,
RA   Larimer,F., Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P.,
RA   Woyke,T., Wu,D., Pukall,R., Klenk,H.-P. and Eisen,J.A.;
RT   "Direct Submission";
RL   Submitted (03-SEP-2009) US DOE Joint Genome Institute, 2800 Mitchell
RL   Drive, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001727.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083332
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3018755
FT                   /strain="DSM 446"
FT                   /mol_type="genomic DNA"
FT                   /organism="Alicyclobacillus acidocaldarius subsp.
FT                   acidocaldarius DSM 446"
FT                   /db_xref="taxon:521098"
FT                   /culture_collection="DSM:446"
FT   gene            112..1476
FT                   /db_xref="GeneID:8426153"
FT                   /locus_tag="Aaci_0001"
FT   CDS_pept        112..1476
FT                   /locus_tag="Aaci_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: geo:Geob_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="GI:258510021"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="GeneID:8426153"
FT                   /translation="MMSTKVDPTYDALWNQVLQMVQDKVSGPTYSTWFEDTHIVRIDES
FT                   EQTVYISAPSTFVRNWLSEHYTSLVETLMMTLMDREYRVRFITEDDVQAPAVIVRRAPE
FT                   PVTAEEDTETNLNPRYTFDSFVIGAGNRFAHAACLAVAERPANAYNPLFIYGGVGLGKT
FT                   HLMHAIGHYVRQHYPNFKVSYISSERFTNEFIAAIRDKNPDSFRARYRTVDVLLIDDIQ
FT                   FIANKEQTQEEFFHTFNSLHEVGKQIVISSDRPPREIPTLEDRLRSRFEWGLITDIQPP
FT                   DLETRIAILQRKAKADGLDVPVDVLAFIANQIDSNIRELEGALTRVIAYSSLVKEDLSV
FT                   ALAEEALKDLIHPNRPRAVTVNHVQKVVADHYGLKVDDLKGKKRTRNIAFPRQIAMYLT
FT                   RELTDLSLPRIGEAFGGRDHTTVMHACERVHEEMMRDDELRATIERLSQAIRTLT"
FT                   /protein_id="YP_003183455.1"
FT   misc_feature    136..1467
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Aaci_0001"
FT   misc_feature    148..>579
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Aaci_0001"
FT   misc_feature    496..933
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aaci_0001"
FT   misc_feature    577..600
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aaci_0001"
FT   misc_feature    order(580..603,766..768,865..867)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aaci_0001"
FT   misc_feature    754..771
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aaci_0001"
FT   misc_feature    904..906
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aaci_0001"
FT   misc_feature    1192..1461
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Aaci_0001"
FT   misc_feature    order(1261..1263,1285..1290,1309..1311,1327..1335,
FT                   1360..1374,1381..1383,1390..1395)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Aaci_0001"
FT   gene            1704..2828
FT                   /db_xref="GeneID:8423460"
FT                   /locus_tag="Aaci_0002"
FT   CDS_pept        1704..2828
FT                   /locus_tag="Aaci_0002"
FT                   /gene_family="HOG000071792" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="KEGG: amc:MADE_00003 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; SMART: DNA polymerase III
FT                   beta chain"
FT                   /db_xref="GI:258510022"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:8423460"
FT                   /translation="MEFSLQKQALSNALQIVSKAVAVRTPKQVLMGILIEVHEDEIVAT
FT                   AYDLELAIQTRVPVGEETGLRVHQTGAIVLPARYFGDIVRKLPDTEIHMRVDANYMTEI
FT                   SAQSVEFHLHGIDAEEFPELPNFMGYESMQIPASTLGRLIESTVFAAATSEVRPVLTGV
FT                   SITSDPTHLTFIATDGLRLAQHRVPQADLPERQVVIPAKSLSELSKILPEDETSVEMVL
FT                   TPSHGLFVIGPTRFYTRLLEGTYPDTSRLIPRSARTQVVLDGDAFLHAIDRAALIARDK
FT                   DNHMVRLEVTGDTLTVTSHSPEVGNVSETLHALRKEGEDLQIAFNGRYVIEAVRALDAA
FT                   EIAIRFNGANQAFVIERSGDPSMLQLISPILWRS"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_003183456.1"
FT   misc_feature    1704..2813
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:168148"
FT                   /locus_tag="Aaci_0002"
FT   misc_feature    1704..2813
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Aaci_0002"
FT   misc_feature    order(1773..1775,1935..1937,1956..1958,2307..2309)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Aaci_0002"
FT   misc_feature    order(1938..1940,1947..1949,2025..2027,2031..2033,
FT                   2529..2531,2625..2630)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Aaci_0002"
FT   misc_feature    order(2232..2234,2238..2249,2679..2681,2805..2813)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Aaci_0002"
FT   misc_feature    order(2232..2234,2238..2243,2454..2456,2562..2564,
FT                   2601..2606,2688..2690,2805..2813)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Aaci_0002"
FT   gene            2828..3058
FT                   /db_xref="GeneID:8423461"
FT                   /locus_tag="Aaci_0003"
FT   CDS_pept        2828..3058
FT                   /locus_tag="Aaci_0003"
FT                   /gene_family="HOG000074028" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /codon_start="1"
FT                   /product="S4 domain protein YaaA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG: gsu:GSU0464
FT                   S4 domain-containing protein"
FT                   /db_xref="GI:258510023"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="GeneID:8423461"
FT                   /translation="MDVHIRGEHITLGQLLKKVQIVASGGEVKSFLAEGRVRVNGAMET
FT                   RRGRKLRDGDEVEVEGAVYRVVSEPDGHPPR"
FT                   /protein_id="YP_003183457.1"
FT   misc_feature    2834..3007
FT                   /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
FT                   domain surface is populated by conserved, charged residues
FT                   that define a likely RNA-binding site;  Found in stress
FT                   proteins, ribosomal proteins and tRNA synthetases; This may
FT                   imply a hitherto unrecognized...; Region: S4; cl09940"
FT                   /db_xref="CDD:175052"
FT                   /locus_tag="Aaci_0003"
FT   gene            3039..4154
FT                   /db_xref="GeneID:8423462"
FT                   /locus_tag="Aaci_0004"
FT   CDS_pept        3039..4154
FT                   /locus_tag="Aaci_0004"
FT                   /gene_family="HOG000269559" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gme:Gmet_0003 recombination
FT                   protein F"
FT                   /db_xref="GI:258510024"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="GeneID:8423462"
FT                   /translation="MDIRRVELHDFRNYAKAEIELSPGVNVLVGENGQGKTNALEAMLL
FT                   IAVGKSHRAHRDRDLIRWEQDRARILLEASTRYGDRRLTLELGPEGRRAFANGVQVGRM
FT                   TEFVGQVQVVLFAPEDLDLVKGSPRVRRRFLDTELGQMEPLYLHHLSLYNRALLQRNRW
FT                   LKTAPLSPDDDVLATFDRQIAFHGAHVIHRRLRFLARLRAYAARIYSDIASGREEFALA
FT                   YRSSVSGVEEGMSVEEMADTVQRALEKNRAQDLRFGTTSAGPHRDDILLFLDGREVHTA
FT                   ASQGQQRTIALSLRLAEIDFMHEELGEYPVLLLDDVLSELDDLRQRNLVLGMSRKVQTV
FT                   ITTTSLNRLGQELDDFRLFRVCSGIIAEERV"
FT                   /protein_id="YP_003183458.1"
FT   misc_feature    3045..>3533
FT                   /note="RecF is a recombinational DNA repair ATPase that
FT                   maintains replication in the presence of DNA damage.  When
FT                   replication is prematurely disrupted by DNA damage, several
FT                   recF pathway gene products play critical roles processing
FT                   the arrested replication...; Region: ABC_RecF; cd03242"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Aaci_0004"
FT   misc_feature    3126..3149
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Aaci_0004"
FT   misc_feature    order(3135..3140,3144..3152,3339..3341)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Aaci_0004"
FT   misc_feature    3330..3341
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Aaci_0004"
FT   misc_feature    <3825..4139
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Aaci_0004"
FT   misc_feature    3882..3911
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0004"
FT   misc_feature    3969..3986
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0004"
FT   misc_feature    3993..4004
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0004"
FT   misc_feature    4059..4079
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0004"
FT   gene            4233..6146
FT                   /db_xref="GeneID:8423463"
FT                   /locus_tag="Aaci_0005"
FT   CDS_pept        4233..6146
FT                   /locus_tag="Aaci_0005"
FT                   /gene_family="HOG000075154" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: glo:Glov_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:258510025"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="GeneID:8423463"
FT                   /translation="MADRIPEQVYDESQIEVLEGLQAVRKRPGMYIGSTSAKGLHHLVW
FT                   EIVDNAVDEALAGRCTRIVVQVHPDNSVTVIDNGAGFPVGIHPKTGRPAVETVLTTLHA
FT                   GGKFGGKGYKVSGGLHGVGASVVNALSEWMRVEVHRDGRIYVQEYERGTPLYDLKVIGT
FT                   TDKTGTKVSFKPDPEIFTETTVFSAETLMNRLRELAFLNAGLEIVFEDEREGGKRAVFK
FT                   YDGGVAEFVRWLNQSKDVLFDDPIYVSAVKDDVAVEIALQYNDGYAATVYSFANNINTA
FT                   EGGTHEAGFKSALTRVINDYARRYGFLKSNDNSMTGDDVREGLTAVVSVKVPEPQFEGQ
FT                   TKTKLGNSEVRGIVETLFAERMQMFLEENPSIARKIVEKCILAARAREAARRARELTRS
FT                   KKMDVTSLPGKLTDCSSKDPERSELFLVEGDSAGGSAKMGRDPQTQAILPLRGKIINVE
FT                   KARLDKVLANEEIRAIITACGTGIGDDFDISKARYHKIVIMTDADHDGSHIRILLLTLF
FT                   YRFMRPLIDAGYIYIAQPPLYKIEKGKVVRYAYSDAQLEQILQEMGREGVRLQRYKGLG
FT                   EMNADQLWETTMDPESRTLLRVTMEDAMDADMIFSILMGDKVEPRRDFIAEHARFVRNL
FT                   DV"
FT                   /product="DNA gyrase, B subunit"
FT                   /protein_id="YP_003183459.1"
FT   misc_feature    4260..6143
FT                   /note="DNA gyrase, B subunit; Region: gyrB; TIGR01059"
FT                   /db_xref="CDD:162180"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    4350..4691
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    order(4368..4370,4380..4382,4389..4391,4455..4457,
FT                   4461..4463,4467..4469,4473..4478,4593..4604,4665..4667,
FT                   4671..4673,4686..4691)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    4380..4382
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    order(4467..4469,4473..4475,4593..4595,4599..4601)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    4905..5378
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    5058..5060
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    order(5232..5234,5241..5246,5250..5252)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    order(5250..5252,5256..5258)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    5496..5837
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    order(5514..5519,5526..5528,5733..5735,5739..5741,
FT                   5745..5747)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    order(5514..5516,5733..5735)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Aaci_0005"
FT   misc_feature    5919..6107
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Aaci_0005"
FT   gene            6202..8664
FT                   /db_xref="GeneID:8423464"
FT                   /locus_tag="Aaci_0006"
FT   CDS_pept        6202..8664
FT                   /locus_tag="Aaci_0006"
FT                   /gene_family="HOG000076279" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: gur:Gura_0005 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="GI:258510026"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="GeneID:8423464"
FT                   /translation="MADESSSRGILPVDISQELRNSFLDYAMSVIVARAIPDVRDGLKP
FT                   VHRRILYAMYEAGMTPDKPYKKSSRIVGDVLGKFHPHGDAAVYEALVRLAQDFSTRYPL
FT                   IDGHGNFGSIDGDAAAAMRYTESRMSAIALELLRDINKETVDFIPNYDEQEEEPVVLPS
FT                   RFPNLLVNGSSGIAVGMATNIPPHNLREVIDGVVMLIDHPDATLDDLMTVIKGPDFPTG
FT                   GVILGREGIRKAYETGRGSITVRAVTHFEELSGGKTRIVVTEIPYQQNKARIVEKIAEL
FT                   AREKKIDGITDLRDESDRRGMRVVIELRRDVRPQVVLNNLFKHTALQTSFGVINLALVN
FT                   GEPKVLTLRETLEHYLNHQRDVVRRRTQYDLAKAEARAHILEGLRIALDHLDEVISLIR
FT                   SSRTVDEARQGLISTFGLSEEQAQAILDMRLQRLTGLEREKIEAEYQELQQRIAELKAI
FT                   LADPKLLDGVIRQEILEIKERFGDERRTRIVNAEGEISEEDLIPVHDVVIAITHRGYIK
FT                   RLPLSTYHSQRRGGRGMTLINAHEEDFVTGLHVTSTHDYLLFFTNRGRMYAIKAYDVPE
FT                   FGRQARGTPIVNLLNIEQGEKVTAMIPVKSLDPAEIGDTYLFFATRQGIVKKTPLAEYS
FT                   NVRKNGLIAINLRDDDDLVGVKLTDGTKEIMMVTRNGLAIRFPETDVRPMGRAATGVKG
FT                   ISLSEGDEVIAMDVAEDDHDVLVVTSRGYGKRTPVSEYRAQSRGGKGIKTLNCTPKNGH
FT                   AIEMCMVTEDDDVMIVTQAGVAIRIHVRDVSTLSRNTQGVRLINVDEGVEVASVSRVVK
FT                   DDDEDSEP"
FT                   /product="DNA gyrase, A subunit"
FT                   /protein_id="YP_003183460.1"
FT   misc_feature    6238..7599
FT                   /note="DNA Topoisomerase IV; Region: TOP4c; smart00434"
FT                   /db_xref="CDD:128711"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    6295..7629
FT                   /note="DNA Topoisomerase, subtype IIA; domain A'; bacterial
FT                   DNA topoisomerase IV (C subunit, ParC), bacterial DNA
FT                   gyrases (A subunit, GyrA),mammalian DNA toposiomerases II.
FT                   DNA topoisomerases are essential enzymes that regulate the
FT                   conformational changes in...; Region: TOP4c; cd00187"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    order(6295..6378,6391..6540,6544..6600,6604..6675,
FT                   6682..6684)
FT                   /note="CAP-like domain; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    6571..6573
FT                   /note="active site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    order(7366..7374,7381..7392,7423..7428,7468..7518)
FT                   /note="primary dimer interface; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    7711..7860
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    7861..8019
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    8041..8184
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    8185..8334
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    8335..>8439
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Aaci_0006"
FT   misc_feature    8488..8631
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Aaci_0006"
FT   gene            8731..8844
FT                   /db_xref="GeneID:8423465"
FT                   /locus_tag="Aaci_0007"
FT   CDS_pept        8731..8844
FT                   /locus_tag="Aaci_0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510027"
FT                   /db_xref="GeneID:8423465"
FT                   /translation="MQNAFWDFVVHTSAMFLAFATFVGLCFIVVNAIVKEK"
FT                   /protein_id="YP_003183461.1"
FT   gene            8883..9671
FT                   /db_xref="GeneID:8423466"
FT                   /locus_tag="Aaci_0008"
FT   CDS_pept        8883..9671
FT                   /locus_tag="Aaci_0008"
FT                   /gene_family="HOG000060394" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   acetyltransferase, GNAT family-related protein"
FT                   /db_xref="GI:258510028"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:8423466"
FT                   /translation="MFRRLTASDHDRVVAYLSKRPALHTFLTGDIERYGYDAPFQEVYG
FT                   YLSDGRVTAVLLRFYGSYIFSTEGPEGVEDVVRMLQSNTAWSMVQGDSVSLSLLQDVGG
FT                   FQPRQVREFAFAERPPHAPRPFVDTAGVYQATVDHVGQLWQLRKSIAEFANSNTTELSL
FT                   RQSFESGDTLCFYVPGERGEMAASASAVAENTWTAMVVGVCTRPLYRGLGYATRCVAKL
FT                   CDVFDERGKTLCLYYDNPNAGGIYRRLGFAVTSGWTQFFR"
FT                   /protein_id="YP_003183462.1"
FT   misc_feature    8883..9656
FT                   /note="Predicted acetyltransferase [General function
FT                   prediction only]; Region: COG3393"
FT                   /db_xref="CDD:33200"
FT                   /locus_tag="Aaci_0008"
FT   misc_feature    9438..9635
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Aaci_0008"
FT   gene            9757..10137
FT                   /db_xref="GeneID:8423467"
FT                   /locus_tag="Aaci_0009"
FT   CDS_pept        9757..10137
FT                   /locus_tag="Aaci_0009"
FT                   /gene_family="HOG000014707" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SYN_03352"
FT                   /codon_start="1"
FT                   /product="cytidine deaminase"
FT                   /transl_table="11"
FT                   /note="KEGG: sat:SYN_03352 cytidine deaminase"
FT                   /db_xref="GI:258510029"
FT                   /db_xref="GeneID:8423467"
FT                   /translation="MTFDELIARAQSVHGIRQLSPEATAGSVAAALETDRGHVYVGVCI
FT                   DTACSLGFCAEHAAAAAMITAGENRVVRMVAVGRDGRILPPCGRCREFIRQLHPDNREA
FT                   EVMVASGVIVRLGELLPHDWLA"
FT                   /protein_id="YP_003183463.1"
FT   misc_feature    9838..10059
FT                   /note="Cytidine deaminase zinc-binding domain. These
FT                   enzymes are Zn dependent. The zinc ion in the active site
FT                   plays a central role in the proposed catalytic mechanism,
FT                   activating a water molecule to form a hydroxide ion that
FT                   performs a nucleophilic attack on...; Region:
FT                   cytidine_deaminase; cd01283"
FT                   /db_xref="CDD:29826"
FT                   /locus_tag="Aaci_0009"
FT   misc_feature    order(9838..9840,9886..9888,9892..9894,9916..9924,
FT                   10015..10017,10024..10026)
FT                   /note="active site"
FT                   /db_xref="CDD:29826"
FT                   /locus_tag="Aaci_0009"
FT   misc_feature    order(9916..9924,10012..10017,10024..10026)
FT                   /note="catalytic motif; other site"
FT                   /db_xref="CDD:29826"
FT                   /locus_tag="Aaci_0009"
FT   misc_feature    order(9916..9918,9922..9924,10015..10017,10024..10026)
FT                   /note="Zn binding site; other site"
FT                   /db_xref="CDD:29826"
FT                   /locus_tag="Aaci_0009"
FT   gene            10137..10520
FT                   /db_xref="GeneID:8423468"
FT                   /locus_tag="Aaci_0010"
FT   CDS_pept        10137..10520
FT                   /locus_tag="Aaci_0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510030"
FT                   /db_xref="GeneID:8423468"
FT                   /translation="MAKAVAPGVEGGSAVKAETLEDVLRDPEFRRQYPPEFLKVLEDPK
FT                   FGQEFQRFVEWAESLIDTKNIGKMSLDELAESVAKRLWGVVLTMFERQVIEMERAGRDV
FT                   SHLRAWLARHGRFPEREDEEGDA"
FT                   /protein_id="YP_003183464.1"
FT   misc_feature    <10140..>10346
FT                   /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
FT                   ligand-binding domain superfamily; Region: SRPBCC; cl14643"
FT                   /db_xref="CDD:176942"
FT                   /locus_tag="Aaci_0010"
FT   gene            10789..12313
FT                   /db_xref="GeneID:8423469"
FT                   /locus_tag="Aaci_R0001"
FT   rRNA            10789..12313
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT                   /db_xref="GeneID:8423469"
FT                   /locus_tag="Aaci_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            12430..15373
FT                   /db_xref="GeneID:8423470"
FT                   /locus_tag="Aaci_R0002"
FT   rRNA            12430..15373
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT                   /db_xref="GeneID:8423470"
FT                   /locus_tag="Aaci_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            15565..15680
FT                   /db_xref="GeneID:8423471"
FT                   /locus_tag="Aaci_R0003"
FT   rRNA            15565..15680
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT                   /db_xref="GeneID:8423471"
FT                   /locus_tag="Aaci_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            16155..17639
FT                   /db_xref="GeneID:8423472"
FT                   /locus_tag="Aaci_0011"
FT   CDS_pept        16155..17639
FT                   /locus_tag="Aaci_0011"
FT                   /gene_family="HOG000165754" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.205"
FT                   /transl_table="11"
FT                   /note="KEGG: gsu:GSU2195 inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="GI:258510031"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="GeneID:8423472"
FT                   /translation="MTSAWEHKFVGEALTFDDVLLLPAHSTVLPRDVDVSTRLTTDIRL
FT                   NIPIVSAAMDTVTTSPMAIAMAREGGIGIIHKNMSIEAQAEEVDRVKRSESGVITNPIY
FT                   LTPDKPLRDAEALMSKYRISGVPIVECGSQKLIGIITNRDLRFERDDSRPIGEVMTREN
FT                   LITAPVGTTLAEAKEILQRHKIEKLPLVDAEGNLRGLITIKDIENARRFPNAAKDSQGR
FT                   LLVGAAVTVSPDVMDRVDALVAAHCDVIVVDTAHGHSEFVLKVVREIRSRYPDIQLIGG
FT                   NVATAAGCEALMEAGVNAVKVGIGPGSICTTRVVAGVGVPQITAIYDCSNAARKRGIPI
FT                   IADGGIKYSGDIVKAISAGASSVMIGSLLAGTAESPGEIEIYQGRQFKVYRGMGSIGAM
FT                   RAGSGDRYFQGDNSEGDTKKLVPEGIEGRVAYRGPVSETLYQLVGGLRSGMGYTGCATI
FT                   QELQEKSQMVRITSAGLRESHPHDVQITKEAPNYSI"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /protein_id="YP_003183465.1"
FT   misc_feature    16167..17636
FT                   /note="inosine 5'-monophosphate dehydrogenase; Reviewed;
FT                   Region: PRK05567"
FT                   /db_xref="CDD:168100"
FT                   /locus_tag="Aaci_0011"
FT   misc_feature    16191..>16430
FT                   /note="TIM barrel proteins share a structurally conserved
FT                   phosphate binding motif and in general share an eight
FT                   beta/alpha closed barrel structure. Specific for this
FT                   family is the conserved phosphate binding site at the edges
FT                   of strands 7 and 8. The phosphate...; Region:
FT                   TIM_phosphate_binding; cl09108"
FT                   /db_xref="CDD:176934"
FT                   /locus_tag="Aaci_0011"
FT   misc_feature    16449..16781
FT                   /note="This cd contains two tandem repeats of the
FT                   cystathionine beta-synthase (CBS pair) domains in the
FT                   inosine 5' monophosphate dehydrogenase (IMPDH) protein.
FT                   IMPDH is an essential enzyme that catalyzes the first step
FT                   unique to GTP synthesis, playing a key...; Region:
FT                   CBS_pair_IMPDH; cd04601"
FT                   /db_xref="CDD:73101"
FT                   /locus_tag="Aaci_0011"
FT   misc_feature    <16812..17564
FT                   /note="IMPDH: The catalytic domain of the inosine
FT                   monophosphate dehydrogenase. IMPDH catalyzes the
FT                   NAD-dependent oxidation of inosine 5'-monophosphate (IMP)
FT                   to xanthosine 5' monophosphate (XMP). It is a rate-limiting
FT                   step in the de novo synthesis of the...; Region: IMPDH;
FT                   cd00381"
FT                   /db_xref="CDD:73364"
FT                   /locus_tag="Aaci_0011"
FT   misc_feature    order(17076..17084,17181..17183,17187..17189,17250..17255,
FT                   17322..17324,17328..17336,17421..17426)
FT                   /note="active site"
FT                   /db_xref="CDD:73364"
FT                   /locus_tag="Aaci_0011"
FT   gene            17733..18617
FT                   /db_xref="GeneID:8423473"
FT                   /locus_tag="Aaci_0012"
FT   CDS_pept        17733..18617
FT                   /locus_tag="Aaci_0012"
FT                   /gene_family="HOG000227586" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /codon_start="1"
FT                   /product="pyridoxal biosynthesis lyase PdxS"
FT                   /transl_table="11"
FT                   /note="with PdxT forms pyridoxal 5'-phosphate from
FT                   glutamine, either ribose 5-phosphate or ribulose
FT                   5-phosphate, and either glyceraldehyde 3-phosphate or
FT                   dihydroxyacetone phosphate"
FT                   /db_xref="GI:258510032"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="GeneID:8423473"
FT                   /translation="MSNVGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPSDIRKAGGVARMADPAIIEEVMNAVSIPVMAKCRIGHIVEARILEAMGVDYIDES
FT                   EVLTPADEKHHIDKTKFTVPFVCGARDLGEALRRIAEGASMIRTKGEPGTGNIVEAVRH
FT                   QRMMQSAIRRVQAMSEDELYAEAKNLGAPYHLLKQVHDLGRLPVVNFAAGGIATPADAA
FT                   LMMELGSDGVFVGSGIFKSENPEKYARAIVQAVTHYQDYELLAHLSKNLGQAMQGIDLA
FT                   TLREEERMAVRGW"
FT                   /protein_id="YP_003183466.1"
FT   misc_feature    17757..18614
FT                   /note="pyridoxal 5'-phosphate synthase, synthase subunit
FT                   Pdx1; Region: TIGR00343"
FT                   /db_xref="CDD:129443"
FT                   /locus_tag="Aaci_0012"
FT   misc_feature    17763..18611
FT                   /note="PdxS is a subunit of the pyridoxal 5'-phosphate
FT                   (PLP) synthase, an important enzyme in deoxyxylulose
FT                   5-phosphate (DXP)-independent pathway for de novo
FT                   biosynthesis of PLP,  present in some eubacteria, in
FT                   archaea, fungi, plants, plasmodia, and some...; Region:
FT                   pdxS; cd04727"
FT                   /db_xref="CDD:73389"
FT                   /locus_tag="Aaci_0012"
FT   misc_feature    order(17802..17804,17859..17861,17973..17975,18189..18197,
FT                   18372..18374,18429..18431)
FT                   /note="active site"
FT                   /db_xref="CDD:73389"
FT                   /locus_tag="Aaci_0012"
FT   misc_feature    order(17904..17906,17910..17912,17934..17936,17979..17981,
FT                   17988..17996,18003..18005,18054..18068,18192..18200,
FT                   18204..18206,18213..18218,18225..18227,18378..18380,
FT                   18387..18392,18513..18515)
FT                   /note="multimer interface; other site"
FT                   /db_xref="CDD:73389"
FT                   /locus_tag="Aaci_0012"
FT   gene            18694..19275
FT                   /db_xref="GeneID:8423474"
FT                   /locus_tag="Aaci_0013"
FT   CDS_pept        18694..19275
FT                   /locus_tag="Aaci_0013"
FT                   /gene_family="HOG000039949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /codon_start="1"
FT                   /product="SNO glutamine amidotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   dds:Ddes_1897 SNO glutamine amidotransferase"
FT                   /db_xref="GI:258510033"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="GeneID:8423474"
FT                   /translation="MKIAVIAVQGAFREHIAALKSLGVEAYEAKWARDLEGADGVIIPG
FT                   GESTAIGKLMREYDMLEPVRALARAGKPIYGTCAGMIVLAKRIEGEDTVHLGLMDVTVR
FT                   RNSFGRQRESFEAEIDIPAIGAPPFPAVFIRAPHIVSVGEGVEVLATYEDRIVAVRQGN
FT                   LLATSFHPELTDDYRLHQYFLNMAQAPVAH"
FT                   /protein_id="YP_003183467.1"
FT   misc_feature    18694..19209
FT                   /note="Glutamine amidotransferase [Amino acid transport and
FT                   metabolism]; Region: HisH; COG0118"
FT                   /db_xref="CDD:30467"
FT                   /locus_tag="Aaci_0013"
FT   misc_feature    18700..19245
FT                   /note="Glutamine Amidotransferase (GATase_I) involved in
FT                   pyridoxine biosynthesis; Region: GATase1_PB; cd01749"
FT                   /db_xref="CDD:153220"
FT                   /locus_tag="Aaci_0013"
FT   misc_feature    order(18826..18834,18925..18927,19006..19008,19093..19098,
FT                   19201..19203,19207..19209)
FT                   /note="predicted active site; other site"
FT                   /db_xref="CDD:153220"
FT                   /locus_tag="Aaci_0013"
FT   misc_feature    order(18925..18927,19201..19203,19207..19209)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:153220"
FT                   /locus_tag="Aaci_0013"
FT   gene            19295..20575
FT                   /db_xref="GeneID:8423475"
FT                   /locus_tag="Aaci_0014"
FT   CDS_pept        19295..20575
FT                   /locus_tag="Aaci_0014"
FT                   /gene_family="HOG000035938" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.11"
FT                   /transl_table="11"
FT                   /note="KEGG: gbm:Gbem_0108 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="GI:258510034"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR018156"
FT                   /db_xref="GeneID:8423475"
FT                   /translation="MLDIRAIRQQPDVFKAKLKRKKVDPAEIDRLLEADARWRDHLAEV
FT                   ERLKALRNQTSEAIARKKRQGEDASEDIARMREVSDRIQALDEEVRELERQVRDLLLAL
FT                   PNVPHDSVPDGESEDDNPVIKTWGDLPKFSFEPKPHWEIAEALDIVDSERAVKITGSRF
FT                   VLYKGLGARLERALANFMLDFHVERHGYTEMFPAFIANEESLIGTGNLPKFGDEMFKIE
FT                   GLPYYLIPTAEVPLTNYYRDEILSADQLPVKFAGYSACFRSEAGSAGKDTRGLIRLHQF
FT                   QKVELVNLCLPEQSYEVLEQLTREAEAVLEALQLPYRRIEICTGDLGAKDAKKYDIEVW
FT                   LPAQNRYREISSCTNFEDYQARRANLRFRREERGKPEFVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGSVLIPRALVPYMGGIERIAKG"
FT                   /product="seryl-tRNA synthetase"
FT                   /protein_id="YP_003183468.1"
FT   misc_feature    19295..20569
FT                   /note="seryl-tRNA synthetase; Provisional; Region:
FT                   PRK05431"
FT                   /db_xref="CDD:168043"
FT                   /locus_tag="Aaci_0014"
FT   misc_feature    19295..19618
FT                   /note="Seryl-tRNA synthetase N-terminal domain; Region:
FT                   Seryl_tRNA_N; pfam02403"
FT                   /db_xref="CDD:145510"
FT                   /locus_tag="Aaci_0014"
FT   misc_feature    19652..20545
FT                   /note="Seryl-tRNA synthetase (SerRS) class II core
FT                   catalytic domain. SerRS is responsible for the attachment
FT                   of serine to the 3' OH group of ribose of the appropriate
FT                   tRNA. This domain It is primarily responsible for
FT                   ATP-dependent formation of the enzyme...; Region:
FT                   SerRS_core; cd00770"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Aaci_0014"
FT   misc_feature    order(19754..19771,19778..19798,19808..19810,19814..19816,
FT                   19820..19822,19829..19831,19868..19879,19883..19891,
FT                   19895..19897,19949..19954,19958..19960,19970..19972,
FT                   19997..19999,20009..20011,20021..20023,20069..20071,
FT                   20132..20134,20540..20545)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Aaci_0014"
FT   misc_feature    order(19775..19777,19985..19987,19991..19993,20078..20080,
FT                   20084..20086,20102..20104,20111..20113,20120..20122,
FT                   20126..20128,20135..20137,20141..20143,20147..20149,
FT                   20339..20350,20441..20443,20447..20449,20465..20467)
FT                   /note="active site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Aaci_0014"
FT   misc_feature    19868..19891
FT                   /note="motif 1; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Aaci_0014"
FT   misc_feature    20075..20086
FT                   /note="motif 2; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Aaci_0014"
FT   misc_feature    order(20450..20458,20465..20467)
FT                   /note="motif 3; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Aaci_0014"
FT   gene            20594..21067
FT                   /db_xref="GeneID:8423476"
FT                   /locus_tag="Aaci_0015"
FT   CDS_pept        20594..21067
FT                   /locus_tag="Aaci_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510035"
FT                   /db_xref="GeneID:8423476"
FT                   /translation="MRISNIRVRLSADDLNSMIAEFAPDIPLRILAIQPDGVHGQFKFL
FT                   MWNIDFAARPTCSADKGEISIEISARKLVNIPPAIVQMSLQEAMKDAPQGIEVLRQSLR
FT                   LNIASLLEPLGIALKLNEFTCAEGALVIDLARVEVEMKGRTSELRSMWKRRGE"
FT                   /protein_id="YP_003183469.1"
FT   gene            21114..22826
FT                   /db_xref="GeneID:8423477"
FT                   /locus_tag="Aaci_0016"
FT   CDS_pept        21114..22826
FT                   /locus_tag="Aaci_0016"
FT                   /gene_family="HOG000054766" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09818"
FT                   /codon_start="1"
FT                   /product="ABC transporter, ATPase, predicted"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter, ATPase, predicted; KEGG:
FT                   dat:HRM2_34010 ATPase family protein"
FT                   /db_xref="GI:258510036"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="GeneID:8423477"
FT                   /translation="MEALRRHLQSIDGRGYKAYQDLEGRYAFPSFTLAVDHVQGDPFAD
FT                   PSKVRVLVLRGKTAVGDAWIDAPWRRIRCEDLLARRMDEALRRLPNRARGTGKSGLIAI
FT                   DAPGQKVLERTAVQIGRDEIVICLSVGLPAVGRRVLAREAEAMLFEQIPAAVERAVYGL
FT                   REEEIRPAVELADQQEAIRRYLRDHGLVAFVANGSILPRESGVSDKPLRRGAVPFQSPP
FT                   ELEISIPVPHREEPLRGMGIRRGITLIVGGGFHGKTTLLEALEHGVYDHVAGDGREFVI
FT                   TDRGAVKIRAEDGRSVAQVDISPLIGTLPHGKDTTRFSTEDASGSTSQAASLVEMIEAG
FT                   ATAFLIDEDTSATNLLVRDARMQALVAKSGEPITPYVDKARQLFDEYGISTVLVVGGLG
FT                   DYFDIADCVIKMEAYVPHDVTAEAKRVAAAIPTARKPEGGHAFGAIRQRVPQPDSLNSQ
FT                   RGHKAKVAARGRYAIQYGATEISLHALEQLVDDSQTRAIAAALSYMERKGWLTKALTVR
FT                   EILDAMEAQWDRDGLGSISLRQGHPGDLARPRRYELAAALNRLRTLRCEQRSE"
FT                   /protein_id="YP_003183470.1"
FT   misc_feature    21114..22457
FT                   /note="Predicted ATPase of the ABC class; Region:
FT                   ABC_ATPase; pfam09818"
FT                   /db_xref="CDD:150482"
FT                   /locus_tag="Aaci_0016"
FT   gene            23019..23097
FT                   /note="tRNA-Arg1"
FT                   /db_xref="GeneID:8423478"
FT                   /locus_tag="Aaci_R0004"
FT   tRNA            23019..23097
FT                   /db_xref="GeneID:8423478"
FT                   /locus_tag="Aaci_R0004"
FT                   /product="tRNA-Arg"
FT   gene            complement(23592..24635)
FT                   /db_xref="GeneID:8423479"
FT                   /locus_tag="Aaci_0017"
FT   CDS_pept        complement(23592..24635)
FT                   /locus_tag="Aaci_0017"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ping_2688"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pin:Ping_2688 hypothetical protein"
FT                   /db_xref="GI:258510037"
FT                   /db_xref="GeneID:8423479"
FT                   /translation="MTPLERLRERYRLRIQERGVRADEMLDVLREIYSQRVRNLMMAMI
FT                   SSCLIADWVSSQAMDPSVLTPEMTEAFHLQYPHLTFDDLRRMSPAELQGVVNGWSGKLF
FT                   EVMVRDMLNKGEWVGDIHLQPGQHAVLADSPTQPGWDIRIVNADGSTDELLQLKATSSL
FT                   SYVKAAIEQHPNIHVIATSDVFDHGTQLSDALLDHVTNSGIGEDMLREFINDTLSGNDT
FT                   RHHFLEALEPGLPLLMILAQELRQVRAGSKSAKAAKKEAFTRLLKSGSISLVTHGLHAL
FT                   GATTGITVPVSFLMRTGMTRISVFNQLTYKLEKRTQELQKWYQMSTWNKPPERSFSYGR
FT                   SASEHNT"
FT                   /protein_id="YP_003183471.1"
FT   gene            complement(25130..26248)
FT                   /db_xref="GeneID:8423480"
FT                   /locus_tag="Aaci_0018"
FT   CDS_pept        complement(25130..26248)
FT                   /locus_tag="Aaci_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /codon_start="1"
FT                   /product="nuclease (SNase domain protein)"
FT                   /transl_table="11"
FT                   /note="PFAM: nuclease (SNase domain protein); SMART:
FT                   nuclease (SNase domain protein); KEGG: hypothetical
FT                   protein"
FT                   /db_xref="GI:258510038"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="GeneID:8423480"
FT                   /translation="MFRKNVWKSSLFALGGLAVSFFVGLVPTAVADSRVGLHAPTGLMA
FT                   ATVTRDIDGDTMQVRIGPKTETVRMLLIDTPEQVDPKTPVEPYAREASAYAKRLLPVGK
FT                   RVWLQEGHPGHTRDKYGRLLAYVWITSTDLYNRDVVDQGLARVAYVYAPNTDYLAQLEA
FT                   AQNDAKWHHRGIWSIPGYVTSQGFNLDVAQKWLQAHSSSNRSSSGEDETSHGGFPVSSS
FT                   SGGKNSSVGIGNAGFPPPSQTNSNASSPDWGSAVGPSTSVSPDPSTPVGRAPASDTAEG
FT                   QSSITVISSDLNVQRGGYASVTIQTTPGALGTIEVDYKTGPSHASGLEPKTADSSGRIT
FT                   WEWRVGSSTTAGQWPVTIAVGGQSITLTLSVS"
FT                   /protein_id="YP_003183472.1"
FT   misc_feature    complement(25718..26125)
FT                   /note="Staphylococcal nuclease homologues; Region: SNc;
FT                   smart00318"
FT                   /db_xref="CDD:128613"
FT                   /locus_tag="Aaci_0018"
FT   misc_feature    complement(25718..26095)
FT                   /note="Staphylococcal nuclease homologues. SNase homologues
FT                   are found in bacteria, archaea, and eukaryotes. They
FT                   contain no disufide bonds; Region: SNc; cd00175"
FT                   /db_xref="CDD:29137"
FT                   /locus_tag="Aaci_0018"
FT   misc_feature    complement(order(25883..25885,25889..25894,26018..26020,
FT                   26027..26029,26045..26047,26084..26086))
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:29137"
FT                   /locus_tag="Aaci_0018"
FT   gene            complement(26460..26741)
FT                   /db_xref="GeneID:8423481"
FT                   /locus_tag="Aaci_0019"
FT   CDS_pept        complement(26460..26741)
FT                   /locus_tag="Aaci_0019"
FT                   /gene_family="HOG000130865" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0150"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   dvl:Dvul_2770 hypothetical protein"
FT                   /db_xref="GI:258510039"
FT                   /db_xref="InterPro:IPR005357"
FT                   /db_xref="GeneID:8423481"
FT                   /translation="MATRGYPAIFDPYEDGSFVVLFPDFPGCVTQGCNLDDAVAMAEEA
FT                   LTLQLYGIERDGEDLPEPSDPSHVTVPEEVQGQWFVMLIHPRPELFHP"
FT                   /protein_id="YP_003183473.1"
FT   misc_feature    complement(26586..26726)
FT                   /note="Uncharacterized protein family (UPF0150); Region:
FT                   UPF0150; cl00691"
FT                   /db_xref="CDD:153938"
FT                   /locus_tag="Aaci_0019"
FT   gene            27172..27534
FT                   /db_xref="GeneID:8423482"
FT                   /locus_tag="Aaci_0020"
FT                   /pseudo
FT   gene            27889..29079
FT                   /db_xref="GeneID:8423483"
FT                   /locus_tag="Aaci_0021"
FT   CDS_pept        27889..29079
FT                   /locus_tag="Aaci_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510040"
FT                   /db_xref="GeneID:8423483"
FT                   /translation="MSSRRWLVAGFFAPIVVICIFMFTFIPAVRSAGERLSELKVAVVN
FT                   EAGSQGVALQKQLAKHLPFTAITGLDERAARQKLLTGNVEMVIRIPSDFYEKLASGNAH
FT                   LDFELTDALSPNVKSMMQLTEARVTQATNAAVLEVAKWKLDNALMKQVDVAPANTSQSK
FT                   EVAVSAAQREVFLVKLMQQIQRFPTQPVRANEVVVASAPAVAEFLPFLTVVTFFIGSIL
FT                   ASLAAWFALKPFDGSARRRYMAWFETLGYILIVSFAAAATVVGVAQMYGVYPVVHAFRA
FT                   VCSLAISFGAGCGLVGGLIYLLRLPGIGLYALLFPFQMLSSGIALPFDMLPQGYQSVVR
FT                   VLPALHVTRVVNWLYVGVGDVSADLKWLGLTVLLAALVMGLRLVFVRRRQVKEDSI"
FT                   /protein_id="YP_003183474.1"
FT   misc_feature    27889..>28188
FT                   /note="YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm;
FT                   TIGR03061"
FT                   /db_xref="CDD:132105"
FT                   /locus_tag="Aaci_0021"
FT   misc_feature    <28513..29022
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1511"
FT                   /db_xref="CDD:31700"
FT                   /locus_tag="Aaci_0021"
FT   gene            29487..30161
FT                   /db_xref="GeneID:8423484"
FT                   /locus_tag="Aaci_0022"
FT   CDS_pept        29487..30161
FT                   /locus_tag="Aaci_0022"
FT                   /gene_family="HOG000271974" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce0067
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:258510041"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:8423484"
FT                   /translation="MSERMDQWLTELVRLNEDDRVTDRQLNILRAAVEVFAEKGFAAAS
FT                   TSEIAQRAGVAEGTIFRHYKTKKDLLLSITVPVIDEFVGPFLLRDLETILTAQHERFED
FT                   FLRAVLFNRLQFAKKYAQVLRILAQEIPFHPELKAQLKQYVTENVLKRLVGIIEHFQEK
FT                   GEIARIPARTVIRLTVSVILSHVVLRHILFHDAPWRDDEEIEMTVRFIVQGLRPDASRD
FT                   QK"
FT                   /protein_id="YP_003183475.1"
FT   misc_feature    29541..30134
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Aaci_0022"
FT   misc_feature    29568..29708
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Aaci_0022"
FT   gene            complement(30921..31895)
FT                   /db_xref="GeneID:8423485"
FT                   /locus_tag="Aaci_0023"
FT   CDS_pept        complement(30921..31895)
FT                   /locus_tag="Aaci_0023"
FT                   /gene_family="HOG000246674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.41"
FT                   /transl_table="11"
FT                   /note="KEGG: xca:xccb100_3342 3-oxoacyl-(acyl carrier
FT                   protein) synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; 3-Oxoacyl-[acyl-carrier- protein (ACP)] synthase
FT                   III"
FT                   /db_xref="GI:258510042"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="GeneID:8423485"
FT                   /translation="MYKAVIRGVGSYLPETRLTNVEIEQMVATSDEWIQTRTGIAERRI
FT                   ARPDEATSDFAYLAAQAALADAKLHPTDIDLLIVATETPDYLLPPVACQVQARLGCRNI
FT                   GAFDLHATCAGFLSALQVAEQFVKSGVHEHVLIVGADTLSRFTDYTDRGTCILFADGAG
FT                   AFVVSRSDDRAARGVIATTIHSDGTYFHNLYIPGGGSRTPYGDGAKAKIVMDGRKIFKL
FT                   AVNVMSSTVEELLQKTGRQRDEIDWLIPHQANQRIIDAVAESLDFPQEKVVSTIQNIGN
FT                   NSSATIPIAVDTAIRDGRIQRGDLLMLVAFGGGLVWGGAMVEY"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /protein_id="YP_003183476.1"
FT   misc_feature    complement(30924..31895)
FT                   /note="3-oxoacyl-(acyl carrier protein) synthase III;
FT                   Reviewed; Region: PRK09352"
FT                   /db_xref="CDD:169809"
FT                   /locus_tag="Aaci_0023"
FT   misc_feature    complement(30930..31889)
FT                   /note="Ketoacyl-acyl carrier protein synthase III (KASIII)
FT                   initiates the elongation in type II fatty acid synthase
FT                   systems. It is found in bacteria and plants. Elongation of
FT                   fatty acids in the type II systems occurs by Claisen
FT                   condensation of malonyl-acyl...; Region: KAS_III; cd00830"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Aaci_0023"
FT   misc_feature    complement(order(30954..30956,31311..31316,31332..31349,
FT                   31461..31463,31518..31523,31530..31535,31542..31544,
FT                   31566..31586,31608..31610,31617..31619,31644..31646,
FT                   31650..31652))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Aaci_0023"
FT   misc_feature    complement(order(31053..31055,31143..31145,31557..31559))
FT                   /note="active site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Aaci_0023"
FT   misc_feature    complement(31134..31136)
FT                   /note="CoA binding pocket; other site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Aaci_0023"
FT   gene            32061..32999
FT                   /db_xref="GeneID:8423486"
FT                   /locus_tag="Aaci_0024"
FT   CDS_pept        32061..32999
FT                   /locus_tag="Aaci_0024"
FT                   /gene_family="HOG000005595" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /codon_start="1"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /transl_table="11"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   mxa:MXAN_3034 putative ADP- ribosylglycohydrolase"
FT                   /db_xref="GI:258510043"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="GeneID:8423486"
FT                   /translation="MIALHDRLRGGMWGLLVGDALGEPYVGLQPEEIPPEGEIDMKGPP
FT                   GEWVAVVPPGTWTDDGAQALCLLDSLLTCGRFDPADFAARLIAWHDEGLWTVDGQAFGI
FT                   GWQTKLAIQEMKRGVEPERAGNVRPEGKGNGALMRVLPLALWHRGDDAALVEDAHRQAR
FT                   VTHGHITNQVCCAVYCLWARRILDGQARGEAYEGAIAALRGLYGEDSPYRRSLEQEVRP
FT                   DDPPVTNGDGYVVHTLNAARLALEETSYERVVRRAIQLGRDTDTNAAVAGGLAGVAFGA
FT                   SGIPERWRRQLRGRDMAEPLVESLVRWRLGS"
FT                   /protein_id="YP_003183477.1"
FT   misc_feature    32088..32924
FT                   /note="ADP-ribosylglycohydrolase; Region: ADP_ribosyl_GH;
FT                   cl00614"
FT                   /db_xref="CDD:153890"
FT                   /locus_tag="Aaci_0024"
FT   gene            complement(33000..33848)
FT                   /db_xref="GeneID:8423487"
FT                   /locus_tag="Aaci_0025"
FT   CDS_pept        complement(33000..33848)
FT                   /locus_tag="Aaci_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510044"
FT                   /db_xref="GeneID:8423487"
FT                   /translation="MAIQGWFSRAAASAALLGVCAVSTACGSPTAPSQWMLINHWMIDA
FT                   VTTKQAPLALQCLLIDVNPTSQSVVSSAQLQAPGLHTRSFSQQELQLANDTLEFQLHFN
FT                   AVATRSIRGAEPTLTIATPNWTHTFSFGEMDVTLVPKRVGWLLPLRSFAGESGAFATSH
FT                   VFAMAVKNPLPHAVTFDGFAVGGGVDVERTAYVINPKEIPLTIPKQAKDVRAPIAIAPG
FT                   QTVALYCAFRQPSAYRNVYFQPALQLSYEGQPGYELTNPALYTETKFKGDPTAIYPTVN
FT                   G"
FT                   /protein_id="YP_003183478.1"
FT   gene            complement(34001..35365)
FT                   /db_xref="GeneID:8423488"
FT                   /locus_tag="Aaci_0026"
FT   CDS_pept        complement(34001..35365)
FT                   /locus_tag="Aaci_0026"
FT                   /gene_family="HOG000029894" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG0438"
FT                   /codon_start="1"
FT                   /product="Glycosyltransferase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: azo:azo3253 hypothetical protein"
FT                   /db_xref="GI:258510045"
FT                   /db_xref="GeneID:8423488"
FT                   /translation="MKRRHALIICHDFPPVGGIAVQRPLKFAKYLGEFGWKVTVLTADH
FT                   VYSATPDPSLLDEIPGDVQIVRVTDPVSKQLARWSGRIVGDGSTPAPQASAQARLPLWK
FT                   RLAWGAWKWAQEHALIPDESVVWAIRAGFAARRIVRQRVMDCIYTTSGPQSTQLAGLIA
FT                   SAFTRTPWIADFRDPWTDNLHFHHRGWRAALERRLERMVFARAAAIVTVTDGFWRLFAA
FT                   KYPRRALDIHVIRNGVDEADFPPAPARRRSEGEPFTFFYGGILYSGRSADALFQAVHRL
FT                   LQSGHIAPHRIRIQFAGVLDYPGHHHHARLIRELGLEAVIEPLGYLPRREALARMLAAD
FT                   ATLLIGDQSEQAKDYVPGKLYEYLYAGRPILAMLREGEAADLIRREQAGIIVPPDDPDA
FT                   IAQAMLHLMAQPATERRAWNPAYSRRAQAQQLARLMDDVLAVQTESTAWSMSWDG"
FT                   /protein_id="YP_003183479.1"
FT   misc_feature    complement(34070..35353)
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases. wbuB in E. coli is involved
FT                   in the biosynthesis of the O26 O-antigen.  It has been
FT                   proposed to function as an N-acetyl-L-fucosamine (L-FucNAc)
FT                   transferase; Region: GT1_wbuB_like; cd03794"
FT                   /db_xref="CDD:99968"
FT                   /locus_tag="Aaci_0026"
FT   gene            complement(35362..36729)
FT                   /db_xref="GeneID:8423489"
FT                   /locus_tag="Aaci_0027"
FT   CDS_pept        complement(35362..36729)
FT                   /locus_tag="Aaci_0027"
FT                   /gene_family="HOG000153774" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.22"
FT                   /transl_table="11"
FT                   /note="KEGG: ent:Ent638_3999 UDP-N-acetyl-D-mannosamine
FT                   dehydrogenase; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase; UDP-
FT                   glucose/GDP-mannose dehydrogenase dimerisation; UDP-
FT                   glucose/GDP-mannose dehydrogenase ; 6-phosphogluconate
FT                   dehydrogenase NAD-binding"
FT                   /db_xref="GI:258510046"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="GeneID:8423489"
FT                   /translation="MRTQIAVIGLGYIGLPLSLALCERGETVIGVDVDERKVNELRAGV
FT                   THVMEPYRGESLESILRRHLESARFTATTSLAEAAERADTFIVTVGLPVAGDVVDKTLL
FT                   LACVNDLGRALSPGDLVLIRSTLVPGMMEGEIVPRLASTSGLVPGRDFHVAYAPERVAE
FT                   GRAMEEFQTLDVVVAGLTDACADRAMAVLARLTDGRLHKTSLRVAELSKVVENAQRDVN
FT                   IALAHELKVVAEQHGVDVYELIRMANTHPRVHLLEPNIGVGGFCIPNAYAYLAASLTSE
FT                   EHIPLFSLARQINLTAPHRAARQLDEALRQIGKRLSGARVALLGLGMKDGSNDIRQSPA
FT                   IHFAEILAERGAAVTAFDPTVDPYFPFQAPSLEDCLANADAVAVAAWQAEFDTAPWPDL
FT                   LARARQPLAVLDLKRRLVPSLKQAGWQIRGDSHLPYIAVSAPHVSATRDCAVEMVP"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /protein_id="YP_003183480.1"
FT   misc_feature    complement(<36367..36720)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Aaci_0027"
FT   misc_feature    complement(35488..36717)
FT                   /note="nucleotide sugar dehydrogenase; Region:
FT                   NDP-sugDHase; TIGR03026"
FT                   /db_xref="CDD:163112"
FT                   /locus_tag="Aaci_0027"
FT   misc_feature    complement(35833..36117)
FT                   /note="UDP-glucose/GDP-mannose dehydrogenase family,
FT                   central domain; Region: UDPG_MGDP_dh; pfam00984"
FT                   /db_xref="CDD:144540"
FT                   /locus_tag="Aaci_0027"
FT   misc_feature    complement(35476..35766)
FT                   /note="UDP-glucose/GDP-mannose dehydrogenase family, UDP
FT                   binding domain; Region: UDPG_MGDP_dh_C; pfam03720"
FT                   /db_xref="CDD:146384"
FT                   /locus_tag="Aaci_0027"
FT   gene            37187..38470
FT                   /db_xref="GeneID:8423490"
FT                   /locus_tag="Aaci_0028"
FT   CDS_pept        37187..38470
FT                   /locus_tag="Aaci_0028"
FT                   /gene_family="HOG000238475" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01346"
FT                   /codon_start="1"
FT                   /product="isocitrate lyase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: sml:Smlt0232 putative
FT                   isocitrate lyase"
FT                   /db_xref="GI:258510047"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="GeneID:8423490"
FT                   /translation="MTYFKTAAELEQHWKTDPRWKGVERAYTAEDVIRLRGSVHIEHTL
FT                   AQMGAEKLWRGLHEDGFIRALGALTGNQAVQQVKAGLKAIYVSGWQVAADANLAEHMYP
FT                   DQSLYPSNSVPSLVRRINNALLRADQIQTAEGKGDIDWMVPIVADAEAGFGGPLNVFEL
FT                   MKMMIEAGAAGVHFEDQLSSEKKCGHMGGKVLIPTSHAVRNLTAARLAADVLGVPTVIV
FT                   ARTDANGAFLITSDVDDRDARFITGERTPEGFYRFRGGLEAAIARGLAYAPYADMIWCE
FT                   TSEPNIEEAKRFAEAIKAEFPDKLLAYNCSPSFNWRKKLDPKTIEEFQEIIASFGYKFQ
FT                   FVTLAGFHALNYSMFELAYGYNQRGMGAYSDLQQQEFAAEARGYTATRHQREVGTGYFD
FT                   EVAQVVSGGLSSTTALTGSTEEEQFVEA"
FT                   /protein_id="YP_003183481.1"
FT   misc_feature    37316..38350
FT                   /note="PEP phosphonomutase and related enzymes
FT                   [Carbohydrate transport and metabolism]; Region: PrpB;
FT                   COG2513"
FT                   /db_xref="CDD:32583"
FT                   /locus_tag="Aaci_0028"
FT   misc_feature    37343..38260
FT                   /note="Members of the ICL/PEPM enzyme family catalyze
FT                   either P-C or C-C bond formation/cleavage. Known members
FT                   are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate
FT                   hydrolase (PPH), carboxyPEP mutase (CPEP mutase),
FT                   oxaloacetate hydrolase (OAH), isocitrate...; Region:
FT                   ICL_PEPM; cd00377"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="Aaci_0028"
FT   misc_feature    order(37349..37351,37370..37372,37376..37387,37391..37405,
FT                   37409..37414,37421..37423,37427..37435,37454..37456,
FT                   37466..37471,37493..37498,37505..37516,37520..37525,
FT                   37532..37537,37541..37546,37553..37558,37649..37651,
FT                   37667..37672,37682..37684,37691..37693,37781..37786,
FT                   37793..37795,37802..37807,37814..37816,38231..38239,
FT                   38243..38251,38255..38260)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="Aaci_0028"
FT   misc_feature    order(37442..37444,37448..37456,37499..37501,37631..37633,
FT                   37637..37639,37718..37720,37856..37858,38027..38029,
FT                   38111..38113,38117..38119,38213..38215)
FT                   /note="active site"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="Aaci_0028"
FT   misc_feature    order(37499..37501,37631..37633,37637..37639,37718..37720)
FT                   /note="Mg2+/Mn2+ binding site; other site"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="Aaci_0028"
FT   repeat_region   38912..40569
FT                   /note="CRISPRs"
FT                   /rpt_unit_range="38912..38948"
FT   gene            complement(40643..41866)
FT                   /db_xref="GeneID:8423491"
FT                   /locus_tag="Aaci_0029"
FT   CDS_pept        complement(40643..41866)
FT                   /locus_tag="Aaci_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sfu:Sfum_2384 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:258510048"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:8423491"
FT                   /translation="MRTYGWYRRRSLALLMVADGISVLGDQVGWMGLLWSTMTLTKNAQ
FT                   IMGWLGLAFGLPAVALGPTVGHVLDHTPHKRALITSHVMLGALFASIAVLERLHVLPVW
FT                   ALLMFAIAAGCLTPFSTIGWSVVIPNIVADDELGSVNALMEILWNGAAILGPALGGFAI
FT                   ARVGSSAALFADAISFWLAALCVGMAKVPAQARHAPMTKCQVARSFVQNTLEAMKTLYA
FT                   LRPVWWITIGAWALNLAYGALDIELPLLTHRQFGRGAWILGSLWSTYAISSIAGAAFSG
FT                   WMSKRRRTGVVMAMMIIGWGAAFAPLFWIHAFTLIYVFLACAGLLFGGYPPLARTVVQR
FT                   SVPTQVMGRIMGLRGSLIALGPPLGSWVGGVLDRWLSPSDAISLVGMAVVALGCWLGSR
FT                   SDFWRIEA"
FT                   /protein_id="YP_003183482.1"
FT   misc_feature    complement(40751..41833)
FT                   /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
FT                   /db_xref="CDD:162098"
FT                   /locus_tag="Aaci_0029"
FT   misc_feature    complement(40679..41728)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Aaci_0029"
FT   misc_feature    complement(order(40781..40783,40790..40795,40802..40807,
FT                   40814..40819,40850..40852,40859..40864,40874..40876,
FT                   40883..40888,40895..40897,41036..41038,41048..41050,
FT                   41057..41059,41069..41071,41081..41083,41123..41125,
FT                   41132..41137,41144..41149,41156..41158,41411..41413,
FT                   41429..41434,41441..41446,41480..41482,41489..41494,
FT                   41501..41506,41513..41518,41669..41674,41678..41683,
FT                   41693..41695,41702..41707,41714..41716))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Aaci_0029"
FT   gene            complement(42063..42980)
FT                   /db_xref="GeneID:8423492"
FT                   /locus_tag="Aaci_0030"
FT   CDS_pept        complement(42063..42980)
FT                   /locus_tag="Aaci_0030"
FT                   /gene_family="HOG000010453" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG: scl:sce7756
FT                   uncharacterized ABC-type transport system,permease
FT                   component"
FT                   /db_xref="GI:258510049"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:8423492"
FT                   /translation="MVFSNPEIWALTLSMAIPLALPAVGGTFSERTGVVNIAMEGIMLI
FT                   GAFFGVAFSYWTGNAWIGLLAAIVCGALTALALAWGAIHVSADQTVLGMGINIFAAGLT
FT                   TFLLNTLFGYNGTPVNTPKLPSVSIPGLDRLPYIGVIFTNQSVLVYIGIVLIFLSHWFL
FT                   FSTRLGLRMRSVGENPLAADTLGIPVWRLRYFGVVLSGVFSAIGGAYLSIGILNGFTSN
FT                   MTSGRGYIALAAMIFGKWTPLGSFGAALIFGFSTALGIVLQGHGVSSNILQMIPYALTI
FT                   LALTGLIGRSTPPAADGIPYEPRR"
FT                   /protein_id="YP_003183483.1"
FT   misc_feature    complement(42129..42935)
FT                   /note="Transmembrane subunit (TM) of Treponema pallidum
FT                   (Tp) RbsC-1, RbsC-2 and related proteins. This is a
FT                   functionally uncharacterized subgroup of TMs which belong
FT                   to a larger group of TMs of Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette...; Region:
FT                   TM_PBP1_transp_TpRbsC_like; cd06580"
FT                   /db_xref="CDD:119322"
FT                   /locus_tag="Aaci_0030"
FT   misc_feature    complement(42387..42443)
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119322"
FT                   /locus_tag="Aaci_0030"
FT   gene            complement(43017..44090)
FT                   /db_xref="GeneID:8423493"
FT                   /locus_tag="Aaci_0031"
FT   CDS_pept        complement(43017..44090)
FT                   /locus_tag="Aaci_0031"
FT                   /gene_family="HOG000010341" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG: scl:sce7757
FT                   ABC transporter permease"
FT                   /db_xref="GI:258510050"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:8423493"
FT                   /translation="MKALQSILLPVAASLVAIAIGAILVAALGYNPVSVYGSLISGAFG
FT                   NLGNLGNTLTASLPLIIIGLGIAISFQSGLFNIGADGQYWIGATAAVWVGYHFTSLPGW
FT                   LHMLFCLVAGMIAGALWAGIVPGLTKAFVGAHEVITTMMMSYIAILFARYLIEGGPMQE
FT                   KGYIPQSPLIASNTQFPYFTQGFARSQLSPISMLIAALAVIVAWFLLYKTTLGFSLRSV
FT                   GLNARAAKYAGIRVKLHIVIALALSGLFAGLAGAVQMLGVDHQLLDGFSSNYGYTAIVV
FT                   ALLARNNPLAVVISGLFFGALTTGGQNMQIVSNVPASLTNVLTGLIIFFVGCERIIPQV
FT                   IGWYRRRRSTRAQTPAS"
FT                   /protein_id="YP_003183484.1"
FT   misc_feature    complement(43098..43880)
FT                   /note="Transmembrane subunit (TM) of Treponema pallidum
FT                   (Tp) RbsC-1, RbsC-2 and related proteins. This is a
FT                   functionally uncharacterized subgroup of TMs which belong
FT                   to a larger group of TMs of Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette...; Region:
FT                   TM_PBP1_transp_TpRbsC_like; cd06580"
FT                   /db_xref="CDD:119322"
FT                   /locus_tag="Aaci_0031"
FT   misc_feature    complement(43356..43412)
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119322"
FT                   /locus_tag="Aaci_0031"
FT   gene            complement(44087..45625)
FT                   /db_xref="GeneID:8423494"
FT                   /locus_tag="Aaci_0032"
FT   CDS_pept        complement(44087..45625)
FT                   /locus_tag="Aaci_0032"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce7755 sugar ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="GI:258510051"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8423494"
FT                   /translation="MEAIPALEPVLEVVDLKKWFPGVKANDGVNLTVQAGEVHAILGEN
FT                   GAGKSTLMKVIYGLLEPTSGEIRLFGQPVHFRSPRDAILAGIGMVHQHFMLIPALTVAE
FT                   NVVLGDEPGGLRFDRREAVRRVRELSERYGLAIDPNAKVGDLTVGLQQRVEILKAFYRK
FT                   ARVLILDEPTALLTPQETRELFNIIRALKAEGVPVLFISHKLDEVLEISDRVTVMRAGK
FT                   TVETLETKGATPQMLANLMVGREVVLRVEKPPMEAGSPVLEVRNLRVRSADRHERVKGV
FT                   SLTVRRGEILGIAGIDGNGQFELADAIAGLLRAEAGQIALDGRDITHLSPADRTQLGIA
FT                   YVPQDRQLDGLVLSFDLADNIILRDFRRPPFSRRGILNRRAAESYAKRLIEAFDVRPPD
FT                   FRRKASELSGGNQQKVILAREVSRDPLVLIAAQPTRGLDVGAIEGVHRQLVRLRNEGKA
FT                   VLLISLELDEILSLSDRIAVMHDGEIVGVVNGAEATREQLGLMMTGRRAKEGTA"
FT                   /protein_id="YP_003183485.1"
FT   misc_feature    complement(44114..45604)
FT                   /note="ABC-type uncharacterized transport systems, ATPase
FT                   components [General function prediction only]; Region:
FT                   COG3845"
FT                   /db_xref="CDD:33636"
FT                   /locus_tag="Aaci_0032"
FT   misc_feature    complement(44948..45595)
FT                   /note="This family represents the domain I of the
FT                   carbohydrate uptake proteins that transport only
FT                   monosaccharides (Monos).  The Carb_Monos family is involved
FT                   in the uptake of monosaccharides, such as pentoses (such as
FT                   xylose, arabinose, and ribose) and...; Region:
FT                   ABC_Carb_Monos_I; cd03216"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Aaci_0032"
FT   misc_feature    complement(45476..45499)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Aaci_0032"
FT   misc_feature    complement(order(45017..45019,45113..45118,45350..45352,
FT                   45473..45481,45485..45490))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Aaci_0032"
FT   misc_feature    complement(45350..45361)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Aaci_0032"
FT   misc_feature    complement(45161..45190)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Aaci_0032"
FT   misc_feature    complement(45113..45130)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Aaci_0032"
FT   misc_feature    complement(45095..45106)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Aaci_0032"
FT   misc_feature    complement(45011..45031)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Aaci_0032"
FT   misc_feature    complement(44174..44854)
FT                   /note="This family represents domain II of the carbohydrate
FT                   uptake proteins that transport only monosaccharides
FT                   (Monos).  The Carb_Monos family is involved in the uptake
FT                   of monosaccharides, such as pentoses (such as xylose,
FT                   arabinose, and ribose) and hexoses...; Region:
FT                   ABC_Carb_Monos_II; cd03215"
FT                   /db_xref="CDD:72974"
FT                   /locus_tag="Aaci_0032"
FT   gene            complement(45683..46753)
FT                   /db_xref="GeneID:8423495"
FT                   /locus_tag="Aaci_0033"
FT   CDS_pept        complement(45683..46753)
FT                   /locus_tag="Aaci_0033"
FT                   /gene_family="HOG000010227" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /codon_start="1"
FT                   /product="basic membrane lipoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   mxa:MXAN_5711 Bmp family lipoprotein"
FT                   /db_xref="GI:258510052"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="GeneID:8423495"
FT                   /translation="MQKRIWQSGLSILAAAALVVGCGTNNSSSATNTSNNGSTGNTTST
FT                   SGKTIKVGLVTDTGGLNDNSFNHLAYVGMQEAQKELPNIQTSVVQSQSESDYVPNLSHF
FT                   AQDGYDLVIAVGYLMADAVQQVAKEYPKTHFLIIDDSITGIPNVASAIFQSQQAGYLAG
FT                   VVAGMVQKNHLLKNINSHNTVGVVGGQEIPPVDTYIAGFQQGFHSVDPTGKVIVEYTNS
FT                   FSDEAAGSQYAQNEIAQGADIIFPVAGGTGIGSIKAAQSAKVYAIGVDTDQSYLAPGTV
FT                   ITSAIKRVDTSVFDTIKAVQDGTFKSGVNTFDLANNGVGIAPLISGLPKSVTDAVNQAK
FT                   QEILSGKIQVSATVQK"
FT                   /protein_id="YP_003183486.1"
FT   misc_feature    complement(45791..46603)
FT                   /note="Periplasmic binding domain of basic membrane
FT                   lipoprotein, PnrA, in Treponema pallidum and its homologs
FT                   from other bacteria and Archaea; Region:
FT                   PBP1_BmpA_PnrA_like; cd06354"
FT                   /db_xref="CDD:107349"
FT                   /locus_tag="Aaci_0033"
FT   misc_feature    complement(order(45893..45895,45944..45946,46007..46009,
FT                   46085..46087,46169..46171,46337..46339,46553..46555,
FT                   46580..46585))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107349"
FT                   /locus_tag="Aaci_0033"
FT   gene            47066..47635
FT                   /db_xref="GeneID:8423496"
FT                   /locus_tag="Aaci_0034"
FT   CDS_pept        47066..47635
FT                   /locus_tag="Aaci_0034"
FT                   /gene_family="HOG000078668" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /codon_start="1"
FT                   /product="isochorismatase hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bav:BAV0718
FT                   isochorismatase-family hydrolase"
FT                   /db_xref="GI:258510053"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="GeneID:8423496"
FT                   /translation="MASDVKQTALLVMDVQNGIVSRYIQDAPAMRPFQEAVSAARKAGI
FT                   QVIFVRVAFSEGFPEASPRNKMFAHLAQAGNMTVSADSTQIHESVRPEAGEPVVTKYRV
FT                   SAFAGSNLEVILRAKDITHLVLCGIATSGVVLSTLREAADKDYALIVLKDACLDADPEV
FT                   HRVLVEKVFPRQADVMTVEEWAKTLV"
FT                   /protein_id="YP_003183487.1"
FT   misc_feature    47087..47614
FT                   /note="Isochorismatase family; Region: Isochorismatase;
FT                   pfam00857"
FT                   /db_xref="CDD:144449"
FT                   /locus_tag="Aaci_0034"
FT   misc_feature    47090..47581
FT                   /note="Cysteine hydrolases; This family contains
FT                   amidohydrolases, like CSHase (N-carbamoylsarcosine
FT                   amidohydrolase), involved in creatine metabolism and
FT                   nicotinamidase, converting nicotinamide to nicotinic acid
FT                   and ammonia in the pyridine nucleotide cycle. It...;
FT                   Region: cysteine_hydrolases; cd00431"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Aaci_0034"
FT   misc_feature    order(47105..47107,47366..47368,47465..47467)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Aaci_0034"
FT   misc_feature    47450..47455
FT                   /note="conserved cis-peptide bond; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Aaci_0034"
FT   gene            47654..48286
FT                   /db_xref="GeneID:8423497"
FT                   /locus_tag="Aaci_0035"
FT   CDS_pept        47654..48286
FT                   /locus_tag="Aaci_0035"
FT                   /gene_family="HOG000058039" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bbt:BBta_2483 putative beta-lactamase"
FT                   /db_xref="GI:258510054"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="GeneID:8423497"
FT                   /translation="MEIAPKIHLLECTKGSYSYLVLGDEPVLVDTSMPGRADAMVKALA
FT                   SLGLKPGDLAHIVLTHLDVDHIGNAKRLKELSGATLWAPAPDIPYIEGAEKPKGVRRAI
FT                   AGLMRVERPKVDRALEPGAHVGGLEVVPAPGHTPGHVCLIARDTLLAGDLVTTRGGRLK
FT                   KSPSFLTWDKAALRQSLADVGRLSFDWVCPAHGDPVRRGSLWEALLE"
FT                   /protein_id="YP_003183488.1"
FT   misc_feature    47696..48238
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:174207"
FT                   /locus_tag="Aaci_0035"
FT   gene            complement(48340..48759)
FT                   /db_xref="GeneID:8423498"
FT                   /locus_tag="Aaci_0036"
FT   CDS_pept        complement(48340..48759)
FT                   /locus_tag="Aaci_0036"
FT                   /gene_family="HOG000004135" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   sfr:Sfri_3970 thioesterase superfamily protein"
FT                   /db_xref="GI:258510055"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:8423498"
FT                   /translation="MIHETPIHIRYSDTDLNGHVNNAVYATYMEESRISFLQEVFPGQR
FT                   LPLVIASLHIDFRQETRYPEHTDVVARTWLTRLGRSSFEFFCQICSVRGEVMCEGTAVV
FT                   VHYDFEKRKSAPLPDWAREKLLPYVREPEESNVGV"
FT                   /protein_id="YP_003183489.1"
FT   misc_feature    complement(48436..48753)
FT                   /note="4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes
FT                   the final step in the 4-chlorobenzoate degradation pathway
FT                   in which 4-chlorobenzoate is converted to 4-hydroxybenzoate
FT                   in certain soil-dwelling bacteria. 4HBT forms a
FT                   homotetramer with four active...; Region: 4HBT; cd00586"
FT                   /db_xref="CDD:48031"
FT                   /locus_tag="Aaci_0036"
FT   misc_feature    complement(order(48514..48525,48610..48612,48616..48618,
FT                   48670..48672))
FT                   /note="active site"
FT                   /db_xref="CDD:48031"
FT                   /locus_tag="Aaci_0036"
FT   gene            48839..49336
FT                   /db_xref="GeneID:8423499"
FT                   /locus_tag="Aaci_0037"
FT   CDS_pept        48839..49336
FT                   /locus_tag="Aaci_0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510056"
FT                   /db_xref="GeneID:8423499"
FT                   /translation="MRRIRRLRMAVAIVASAAWLAGCGSPTGYQPQPPAPGVSEFWQIM
FT                   QIRVPEDDAQRFVMDLGLATREREGNYSFWMSALTWRALGKRDHASLYELVIPNCCNIA
FT                   LPSTTVTYGQASNSLVQTVDFEQDERNAVFYISASQPLQWSQTATDAKHQTVSLVFVPV
FT                   AS"
FT                   /protein_id="YP_003183490.1"
FT   gene            49400..49819
FT                   /db_xref="GeneID:8423500"
FT                   /locus_tag="Aaci_0038"
FT   CDS_pept        49400..49819
FT                   /locus_tag="Aaci_0038"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510057"
FT                   /db_xref="GeneID:8423500"
FT                   /translation="MAVVTDILSGLLMAWFSLLFIGINRFCGRVKWKDRDAWQYILLEC
FT                   MLILYFIGSLKRWYFVIPIMAFLFPVWDFLQFRAHWLSWITGASDERLRRYDDAFGDNV
FT                   YLLPKSDRRTVPDAYHTVQHVLMALNTIAVFAMLR"
FT                   /protein_id="YP_003183491.1"
FT   gene            complement(49866..50945)
FT                   /db_xref="GeneID:8423501"
FT                   /locus_tag="Aaci_0039"
FT   CDS_pept        complement(49866..50945)
FT                   /locus_tag="Aaci_0039"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: avn:Avin_21300
FT                   ABC transporter, ATP binding component"
FT                   /db_xref="GI:258510058"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8423501"
FT                   /translation="MKDSNAHRLSAAGVTVAHGQQVAVRRASLTIGAGEIVALVGPSGS
FT                   GKSTLLGAIAGFYPIQSGAIWIGEEMVASPTLSLPPERRRVGMVFQSHALWPQWMVVDN
FT                   VAYPLRRRGMARLLARREAESVLAAVGMDAFAARYPSELSGGQRQRVGLARALASRPEL
FT                   YLFDEPTASLDPANRETFMHEVRERIRQTGAAALYVSHQADEALSLAHRVAVMMHGEIL
FT                   QVGSPAEVYENPRTAEIARLLGPAACATGVVREVNGSGQALVQIADSEQTVRLTSAPRS
FT                   ADLGRRTLMMRPEWCELTADDEASLPCRVVRVQYVGHRTLYELESLAGRLLASHVGPPQ
FT                   YQEGQRVGWKVRRACVMEG"
FT                   /protein_id="YP_003183492.1"
FT   misc_feature    complement(49872..50921)
FT                   /note="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components [Amino acid transport and metabolism];
FT                   Region: PotA; COG3842"
FT                   /db_xref="CDD:33633"
FT                   /locus_tag="Aaci_0039"
FT   misc_feature    complement(50271..50921)
FT                   /note="ABC Carbohydrate and Solute Transporters-like
FT                   subgroup.  This family is comprised of proteins involved in
FT                   the transport of apparently unrelated solutes and proteins
FT                   specific for di- and oligosaccharides and polyols.  ABC
FT                   transporters are a large family...; Region:
FT                   ABC_Carb_Solutes_like; cd03259"
FT                   /db_xref="CDD:73018"
FT                   /locus_tag="Aaci_0039"
FT   misc_feature    complement(50802..50825)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73018"
FT                   /locus_tag="Aaci_0039"
FT   misc_feature    complement(order(50343..50345,50442..50447,50673..50675,
FT                   50799..50807,50811..50816))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73018"
FT                   /locus_tag="Aaci_0039"
FT   misc_feature    complement(50673..50684)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73018"
FT                   /locus_tag="Aaci_0039"
FT   misc_feature    complement(50490..50519)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73018"
FT                   /locus_tag="Aaci_0039"
FT   misc_feature    complement(50442..50459)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73018"
FT                   /locus_tag="Aaci_0039"
FT   misc_feature    complement(50424..50435)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73018"
FT                   /locus_tag="Aaci_0039"
FT   misc_feature    complement(50337..50357)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73018"
FT                   /locus_tag="Aaci_0039"
FT   gene            complement(50942..52591)
FT                   /db_xref="GeneID:8423502"
FT                   /locus_tag="Aaci_0040"
FT   CDS_pept        complement(50942..52591)
FT                   /locus_tag="Aaci_0040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mxa:MXAN_7115 ABC
FT                   transporter, permease protein"
FT                   /db_xref="GI:258510059"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:8423502"
FT                   /translation="MMWRTSWHTAAGTAVLAAAAAVLCVYPVFDLAVELPSAAVLASTL
FT                   GPLWNALWTSAVSSAIASLVGMAWAVMLSGAVRRGRAALHAISLLPLWTPPFIGAFALG
FT                   DAYARAGLLDQWAHVHVGWLYGPWGVTAALAIHAAPIGYLSGLTAIAAMNVEPMWAARS
FT                   CGAGWFRAFWAAFRPVALRPLCAAWALSFAFALGDFGVPYELGEPSGFRTAATSIFANL
FT                   STGGTQGFTAATWQAFELMAVGALAVTVSRGVMRFDPGLGTSAPGAPPLPLFPKRARAI
FT                   SLAAYALYVATTSGLPLAALVLTALTRAYGLPPTPRNWDAAGLLSPLVSAWPALVHTVV
FT                   LATVAAAVIALLGLVAAEAVPASAMARAAHLALWLQYAAPGTAVAVAILVAFGHALYGT
FT                   WWILGLAYVAKFYGLADAIVAARRNAQLDPWRAARSFGAGPAGAYGAAIWPAIRPAVRQ
FT                   VALQALMSGLYEVTLASLLYGPNTQTIAVAVLSASEGGDVRTVAVLAVWMTAASFALGL
FT                   LALREPKRRRSQGLSQLRMAMPAAPLEEVKLG"
FT                   /protein_id="YP_003183493.1"
FT   misc_feature    complement(51839..52459)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Aaci_0040"
FT   misc_feature    complement(51002..>51454)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Aaci_0040"
FT   gene            complement(52588..53598)
FT                   /db_xref="GeneID:8423503"
FT                   /locus_tag="Aaci_0041"
FT   CDS_pept        complement(52588..53598)
FT                   /locus_tag="Aaci_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mxa:MXAN_7114 ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="GI:258510060"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:8423503"
FT                   /translation="MLMKGLSVAAAAVVVAAGVAAWHAEQHPHAPAQAAASAQGAKPAG
FT                   TVTVYAALTQQNAQALAQAFEAYDPAARVQMVTTGTGALVTRLESEAKAHAIGADMVLL
FT                   ADPTAADTLAAQGILSREKPSAASHLPSADQGANWVGAYVFHDVIVYHKGMSLPVPRSW
FT                   RDLTNAAYKGEVEIGDPSYSGTTMAFVGMMETRYGWNYFETLKQNGAAVQSSVKTVADD
FT                   VASGKVDVGMTNDSAAFTLVKQESPIGVVWPQDGAIVVPGPLAFVKGHETPVAKAFANW
FT                   LLSPAGQKVVASVGLSPVLGASPTVPKGASLTQVPWAQLERDRANILREFAQIFR"
FT                   /protein_id="YP_003183494.1"
FT   misc_feature    complement(52591..53379)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Aaci_0041"
FT   gene            complement(53713..54513)
FT                   /db_xref="GeneID:8423504"
FT                   /locus_tag="Aaci_0042"
FT   CDS_pept        complement(53713..54513)
FT                   /locus_tag="Aaci_0042"
FT                   /gene_family="HOG000276829" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /codon_start="1"
FT                   /product="ABC-2 type transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ank:AnaeK_4023
FT                   ABC-2 type transporter"
FT                   /db_xref="GI:258510061"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR013526"
FT                   /db_xref="GeneID:8423504"
FT                   /translation="MQQTSFEAIQARASMATTLRQSLTMAYRGLLKMRRTPEQLFDVTL
FT                   QPIIFTLMFTYIFGGAISGNSQNYLPLVIPGILVQTVITASVVTGVQLREDMDKGVFDR
FT                   FRALPIARMAPLAGALLADMVRYLLATVLIFTVGYLMGYHPRGGLAHVAIAALLVIVCA
FT                   FALSWIFAFFGVVARTAASVQGISMLILFPLTFLSNAFAPVNTMPKWLQVFVNVNPLSH
FT                   LIAAVRSLANQGQATPDIAISLGGAVAIMLVFAPLAVRMYMRKA"
FT                   /protein_id="YP_003183495.1"
FT   misc_feature    complement(53719..54411)
FT                   /note="ABC-2 type transporter; Region: ABC2_membrane;
FT                   cl11417"
FT                   /db_xref="CDD:164215"
FT                   /locus_tag="Aaci_0042"
FT   gene            complement(54513..55526)
FT                   /db_xref="GeneID:8423505"
FT                   /locus_tag="Aaci_0043"
FT   CDS_pept        complement(54513..55526)
FT                   /locus_tag="Aaci_0043"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /codon_start="1"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: aeh:Mlg_2715 daunorubicin resistance ABC
FT                   transporter ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:258510062"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8423505"
FT                   /translation="MQSLKTPTNRLTAATGADALAIEAVDLVKAFGPHRAVDGVSLSVQ
FT                   VGTVYGLLGPNGAGKTTTVRMLATLLRPDAGAARIFGHDVVKDAQRVRQLIGVTGQYAS
FT                   VDETLTAAENLVLFARLLGQSRREARATTERLLGQFGLTEARNRPLKQFSGGMRRRLDL
FT                   AASLIATPPLIFLDEPTTGLDPRTRAQMWDTIRQLVREGTTVLLTTQYLDEADQLANRI
FT                   AVIDRGRVIAEGTPDELKSSVGRSSLHLTFANPEDVPRARALVEAALGAQATPSPEGRR
FT                   IIAPLADTSVVPDLLVALRAAGIDITELGVQKPTLDEVFLALTGHEAETADEGESD"
FT                   /protein_id="YP_003183496.1"
FT   misc_feature    complement(54807..55463)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Aaci_0043"
FT   misc_feature    complement(54552..55442)
FT                   /note="daunorubicin resistance ABC transporter ATP-binding
FT                   subunit; Region: drrA; TIGR01188"
FT                   /db_xref="CDD:130256"
FT                   /locus_tag="Aaci_0043"
FT   misc_feature    complement(55344..55367)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0043"
FT   misc_feature    complement(order(54897..54899,54993..54998,55224..55226,
FT                   55341..55349,55353..55358))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0043"
FT   misc_feature    complement(55224..55235)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0043"
FT   misc_feature    complement(55041..55070)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0043"
FT   misc_feature    complement(54993..55010)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0043"
FT   misc_feature    complement(54975..54986)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0043"
FT   misc_feature    complement(54891..54911)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Aaci_0043"
FT   gene            55675..56349
FT                   /db_xref="GeneID:8423506"
FT                   /locus_tag="Aaci_0044"
FT   CDS_pept        55675..56349
FT                   /locus_tag="Aaci_0044"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: dds:Ddes_0567 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="GI:258510063"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:8423506"
FT                   /translation="MATILVADDEPHIRELVRSTLEREGHRVVEAADGREAADAVAREP
FT                   VQLAVIDVMMPEVDGFELTRWLREERDVPILLLTALGETSHKVRGLRLGADDYLVKPFA
FT                   PEELVARVEALLRRYRIRADGALDLAVLRLLSDTYEVEANGERMALPPKEFQLLFTLAA
FT                   SAGRTLSRDKLIEEVWGYDYAGDERTVDVHIKRLRVKFPEDVYPFRIRTVRGLGYRLEV
FT                   NA"
FT                   /protein_id="YP_003183497.1"
FT   misc_feature    55684..56346
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Aaci_0044"
FT   misc_feature    55687..56022
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Aaci_0044"
FT   misc_feature    order(55696..55701,55828..55830,55852..55854,55909..55911,
FT                   55966..55968,55975..55980)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Aaci_0044"
FT   misc_feature    55828..55830
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Aaci_0044"
FT   misc_feature    order(55837..55842,55846..55854)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Aaci_0044"
FT   misc_feature    55975..55983
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Aaci_0044"
FT   misc_feature    56068..56334
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Aaci_0044"
FT   misc_feature    order(56125..56127,56182..56187,56239..56241,56248..56250,
FT                   56272..56277,56308..56310,56323..56325)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Aaci_0044"
FT   gene            56346..57458
FT                   /db_xref="GeneID:8423507"
FT                   /locus_tag="Aaci_0045"
FT   CDS_pept        56346..57458
FT                   /locus_tag="Aaci_0045"
FT                   /gene_family="HOG000079356" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: gsu:GSU1101 sensory box histidine kinase"
FT                   /db_xref="GI:258510064"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:8423507"
FT                   /translation="MKERAASRGSDDDFRARHQRWQWREALDRLLWMSCWSFVLLSASY
FT                   GVVRLMGRALGWRPVPYGQLMIIGGVGVVMLALVALLWNALGFDRDDRLFFRILDSLSE
FT                   IGRGNFSARAMLEVRRGFPDHPMNQLVLHVREMAEGLERIEQMRQEFVANVSHEMQTPL
FT                   TSILGFVKALKSDGLSEGERRHYLDIIEAESERLSRLADNLLKLTSLESGHHPVTLTRF
FT                   RLDRQLREVAIACEPLWTEKGLFLDMQVEPVELEGDEDLLGQVWMNLLSNAIKFTEPGG
FT                   RIQVRLEKEETGVCVSVADTGIGIRPEDVSRVFTRFFKADRSRGKPGNGLGLAIAKRIV
FT                   EMHRGDISVESEPGRGSTFKVHLPYTQGGR"
FT                   /protein_id="YP_003183498.1"
FT   misc_feature    56778..56969
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Aaci_0045"
FT   misc_feature    order(56796..56798,56808..56810,56820..56822,56829..56831,
FT                   56841..56843,56850..56852,56901..56903,56913..56915,
FT                   56922..56924,56934..56936,56943..56945,56955..56957)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Aaci_0045"
FT   misc_feature    56814..56816
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Aaci_0045"
FT   misc_feature    57129..57434
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0045"
FT   misc_feature    order(57147..57149,57159..57161,57168..57170,57237..57239,
FT                   57243..57245,57249..57251,57255..57260,57333..57344,
FT                   57390..57392,57396..57398,57411..57416,57420..57422)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0045"
FT   misc_feature    57159..57161
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0045"
FT   misc_feature    order(57249..57251,57255..57257,57333..57335,57339..57341)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0045"
FT   gene            57519..57710
FT                   /db_xref="GeneID:8423508"
FT                   /locus_tag="Aaci_0046"
FT   CDS_pept        57519..57710
FT                   /locus_tag="Aaci_0046"
FT                   /gene_family="HOG000101080" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510065"
FT                   /db_xref="GeneID:8423508"
FT                   /translation="MLVAEILLLLLYAAIEFAVGLLFAWAFGRMFRVRLSRKTRLWMAT
FT                   AWAVLGVIPTALGINGGL"
FT                   /protein_id="YP_003183499.1"
FT   gene            57744..58364
FT                   /db_xref="GeneID:8423509"
FT                   /locus_tag="Aaci_0047"
FT   CDS_pept        57744..58364
FT                   /locus_tag="Aaci_0047"
FT                   /gene_family="HOG000122947" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /codon_start="1"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rfe:RF_0832 lysine efflux permease"
FT                   /db_xref="GI:258510066"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:8423509"
FT                   /translation="MVGAFWHGLILAFALILPIGMQNGFLLSQGALHRRWLAALPAVVT
FT                   AALCDTFLVALAVFGVSGAVFHIVWLRVALGMVGVAFLLYMGFQTWRQNPDDHAVTSEV
FT                   WSPRRQIGFAMSVSLLNPHALMDTLAVIGGSAAVYGTWGQRASFAAGCALVSWVWFFFL
FT                   MTLGHVAGRAAAGVGLRRVINRISALMMWASAGLLIHILLTFR"
FT                   /protein_id="YP_003183500.1"
FT   misc_feature    57744..58343
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:174287"
FT                   /locus_tag="Aaci_0047"
FT   gene            complement(58517..61396)
FT                   /db_xref="GeneID:8423510"
FT                   /locus_tag="Aaci_0048"
FT   CDS_pept        complement(58517..61396)
FT                   /locus_tag="Aaci_0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG3534"
FT                   /codon_start="1"
FT                   /product="Alpha-L-arabinofuranosidase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: esa:ESA_01942 hypothetical protein"
FT                   /db_xref="GI:258510067"
FT                   /db_xref="GeneID:8423510"
FT                   /translation="MKRPWSAALAALIALGTGASPAWAAAHPSPKVPAGAAGRVRAADV
FT                   VSTPISMEIQVIHDALTVPELAAVQAAAQAASNLSTSQWLQWLYPNATPTTSAQSQAAQ
FT                   AVANLFNLATYGAVSTRGSNAAQILQTLQSISPLLSPRAVGLFYQSFLTEIGQSSKAIL
FT                   ARQASSSIVGNALAQAASLSPTISAYLRQNGLSPSDLARTWSSFETQVDPQGAAQTALA
FT                   TRICTNALGFGAPTASATITVNTAARLRTVPATAFGLNAAVWDSGLNSQTVISEVQALH
FT                   PALIRWPGGSISDVYNWETNTRNDGGYVNPNDTFDNFMQFVNAVGASPIITVNYGTGTP
FT                   QLAADWVKYADVTHHDNVLYWEIGNEIYGNGYYNGNGWEADDHAVPNQPQKGNPGLSPQ
FT                   AYAQNALQFIQAMRAVDPNIKIGAVLTMPYNWPWGATVNGNDDWNTVVLKALGPYIDFV
FT                   DVHWYPETPGQETDAGLLADTDQIPAMVAELKREINAYAGSNAKNIQIFVTETNSVSYN
FT                   PGQQSTNLPEALFLADDLAGFVQAGAANVDWWDLLNGAEDNYTSPSLYGQNLFGDYGLL
FT                   SSGQATPKGVQEPPQYTPLPPYYGFQLVSDFARPGDTLLGSASSQSDIDVHAVREPNGD
FT                   IALMLVNRSPSTIYSADLNVLGVGPYAITKALVYGEGSSAVSPALTLPTAHSVKLMPYS
FT                   GVDLVLHPLIPAPHAAASVTDTLALSSPTVTAGGSETVTASFSSDRPVRDATVELELYD
FT                   STGDLVANHEMTGVDIAPGQPVSESWTFAAPAANGTYTVEAFAFDPATGATYDADTTGA
FT                   TITVNQPPAAKYGDIVTKNTVITVNGTTYTVPAPDASGHYPSGTNISIAPGDTVTIQTT
FT                   FANVSSTDALQNGLIDMEVDGQNGAIFQKYWPSTTLLPGQTETVTATWQVPSSVSAGTY
FT                   PLNFQAFDTSNWTGNCYFTNGGVVNFVVN"
FT                   /protein_id="YP_003183501.1"
FT   misc_feature    complement(<60008..60580)
FT                   /note="Alpha-L-arabinofuranosidase C-terminus; Region:
FT                   Alpha-L-AF_C; cl01412"
FT                   /db_xref="CDD:154388"
FT                   /locus_tag="Aaci_0048"
FT   gene            61572..62585
FT                   /db_xref="GeneID:8423511"
FT                   /locus_tag="Aaci_0049"
FT   CDS_pept        61572..62585
FT                   /locus_tag="Aaci_0049"
FT                   /gene_family="HOG000220180" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LacI family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: aha:AHA_0114 ribose operon repressor"
FT                   /db_xref="GI:258510068"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="GeneID:8423511"
FT                   /translation="MATVKDIARLAGVSPTTVSWALNGKRVSEESLRKVLEAARELNYH
FT                   PKMSARSLRAGKVFSIGFYIVNPSLDPRLNGYLFPMLAGISKVLAEDNYAMQFDIVTPD
FT                   KLDMLAKKALEHSVDGMLVLPQFAGVTERLLKELPEKFPVVYMQQDPAASPDHCVVIDQ
FT                   AAGVELAIRHLYDLGHRAIGVIAGPAEHVDNVLRLRAVQAVFRDLGLSWREEWVAHGQF
FT                   DMESGEVGMRRILEAPDRPTAVFCFNDYMAIGALRAAASAGLRVPDDISILGFDDTDVA
FT                   EASTPALTTIQQPVFQQGQQAAAMLMRLIKGEELPKQVERIRPVVIERSSAERRRA"
FT                   /protein_id="YP_003183502.1"
FT   misc_feature    61575..62579
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PurR; COG1609"
FT                   /db_xref="CDD:31797"
FT                   /locus_tag="Aaci_0049"
FT   misc_feature    61584..61736
FT                   /note="Helix-turn-helix (HTH) DNA binding domain of the
FT                   LacI family of transcriptional regulators; Region:
FT                   HTH_LacI; cd01392"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Aaci_0049"
FT   misc_feature    order(61584..61586,61608..61622,61626..61631,61638..61640,
FT                   61650..61655,61662..61664,61701..61703,61710..61712,
FT                   61719..61724,61728..61733)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Aaci_0049"
FT   misc_feature    61701..61730
FT                   /note="domain linker motif; other site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Aaci_0049"
FT   misc_feature    61785..62552
FT                   /note="Ligand binding domain of the LacI tanscriptional
FT                   regulator family belonging to the type I
FT                   periplasmic-binding fold protein superfamily; Region:
FT                   PBP1_LacI_sugar_binding_like; cd06267"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="Aaci_0049"
FT   misc_feature    order(61803..61808,61812..61814,61941..61943,62013..62015,
FT                   62052..62054,62160..62162,62235..62237,62397..62399,
FT                   62448..62450)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="Aaci_0049"
FT   misc_feature    order(61806..61811,61818..61823,61827..61832,61851..61865,
FT                   61869..61871,61896..61898,61905..61907,61914..61922,
FT                   62244..62246,62328..62330,62340..62342,62349..62354)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="Aaci_0049"
FT   gene            62582..63133
FT                   /db_xref="GeneID:8423512"
FT                   /locus_tag="Aaci_0050"
FT   CDS_pept        62582..63133
FT                   /locus_tag="Aaci_0050"
FT                   /gene_family="HOG000011232" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04309"
FT                   /codon_start="1"
FT                   /product="glycerol-3-phosphate responsive antiterminator,
FT                   GlpP"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerol-3-phosphate responsive
FT                   antiterminator; KEGG: kpe:KPK_4466 glycerol-3-phosphate
FT                   responsive antiterminator"
FT                   /db_xref="GI:258510069"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="GeneID:8423512"
FT                   /translation="MNPFEGRRVLPAVRSLKDFEELMQGPHPVVVLLETNLTALPSLMR
FT                   MANKAGKRLILHADLIQGLKHDEAGTQFLCQMIRPYGIISTHASVIATAKKQGVIAIQR
FT                   VFLIDSHSLRTSYRVLQQAKPDFLEVLPGVVPQLIAEIREQTGLPVLAGGFVRTKEDVE
FT                   RAVAAGATAVTTSVKALWQL"
FT                   /protein_id="YP_003183503.1"
FT   misc_feature    62606..63070
FT                   /note="Glycerol-3-phosphate responsive antiterminator;
FT                   Region: G3P_antiterm; cl00852"
FT                   /db_xref="CDD:120175"
FT                   /locus_tag="Aaci_0050"
FT   gene            complement(63154..64875)
FT                   /db_xref="GeneID:8423513"
FT                   /locus_tag="Aaci_0051"
FT   CDS_pept        complement(63154..64875)
FT                   /locus_tag="Aaci_0051"
FT                   /gene_family="HOG000239127" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dal:Dalk_2314 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="GI:258510070"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:8423513"
FT                   /translation="MRILDARSPAYKWIALSNTTLGVLMASINGTILIIALPVIFAGIQ
FT                   VNPLQSGQTSLLLWVLMGFNVATTVLLVTFGRLSDMFGRVRLYNLGFLVFTVGSVLCSL
FT                   TWSHGRAGELELIIFRMIQGIGGAFLFSNSAAILTDAFPNNQRGLALGLNQIAAVAGSV
FT                   VGLVLGGILASTGHWRYVFLVNVPIGIIGTVWAYLMLKEMAKPQRDAKLDIPGNATLAL
FT                   GVLALMLALTYGIMPYGGHSMGWTSPMVLALFIGGVVMLGVFGVIERRMPDPLFRLELF
FT                   RIRPFTLGNVALFMGSLARGGLSFMLIIWLQGIYLPLHGVSYENTPLIAGLYTLPQMVG
FT                   FLAAGPLSGYLSDKFGQRAFATGGLLVSAVGFLLLAALPIDFNRFAFWADIFVIGVGMG
FT                   LFASPNNASIMSSVPAQYRGVASGMRSTFNNAGQMMSMGIFFSIVVAGLAAKLPQALVS
FT                   GLTAHGVPVKAAEAIAKLPPTSSLFAALLGYNPLESLLGPNGLNVLSKLPASQVAAITG
FT                   KHFFPTLISPPFHTGLALAFVISAILMVIGAVASIFRGTYQEPQAMSPREAERVAK"
FT                   /protein_id="YP_003183504.1"
FT   misc_feature    complement(63520..64869)
FT                   /note="benzoate transport; Region: 2A0115; TIGR00895"
FT                   /db_xref="CDD:162095"
FT                   /locus_tag="Aaci_0051"
FT   misc_feature    complement(<64273..64815)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Aaci_0051"
FT   misc_feature    complement(order(64390..64392,64408..64413,64420..64425,
FT                   64459..64461,64468..64473,64480..64485,64492..64497,
FT                   64648..64653,64657..64662,64672..64674,64681..64686,
FT                   64693..64695,64762..64767,64771..64779,64786..64788))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Aaci_0051"
FT   misc_feature    complement(<63544..63975)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Aaci_0051"
FT   misc_feature    complement(order(63577..63579,63595..63600,63607..63612,
FT                   63646..63648,63655..63660,63667..63672,63679..63684,
FT                   63829..63834,63838..63843,63853..63855,63862..63867,
FT                   63874..63876,63925..63930,63934..63942,63949..63951))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Aaci_0051"
FT   gene            complement(64872..65345)
FT                   /db_xref="GeneID:8423514"
FT                   /locus_tag="Aaci_0052"
FT   CDS_pept        complement(64872..65345)
FT                   /locus_tag="Aaci_0052"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MerR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: bpy:Bphyt_1823 transcriptional
FT                   regulator, MerR family"
FT                   /db_xref="GI:258510071"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="GeneID:8423514"
FT                   /translation="MDRDKAWTVEAVAERLGITPRTLHYYEEKGLIPEVPRTPGGHRVY
FT                   DEDTIERIEHILRLKEALGYSLQEIRSILSTEDQLKAYRARIAEGHEPEHNVQMLSESV
FT                   RLLEDVVRHIDEKMLRLGSMREHYMDRLARIRARLEREEAATRTVGFPDQEGE"
FT                   /protein_id="YP_003183505.1"
FT   misc_feature    complement(64965..65312)
FT                   /note="Helix-Turn-Helix DNA binding domain of transcription
FT                   regulators from the MerR superfamily; Region: HTH_MerR-SF;
FT                   cl02600"
FT                   /db_xref="CDD:155005"
FT                   /locus_tag="Aaci_0052"
FT   misc_feature    complement(order(65217..65225,65274..65276))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133389"
FT                   /locus_tag="Aaci_0052"
FT   repeat_region   65540..66899
FT                   /note="CRISPRs"
FT                   /rpt_unit_range="65540..65577"
FT   gene            67339..68322
FT                   /db_xref="GeneID:8423515"
FT                   /locus_tag="Aaci_0053"
FT   CDS_pept        67339..68322
FT                   /locus_tag="Aaci_0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /codon_start="1"
FT                   /product="phosphate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphate transporter; KEGG: dar:Daro_0679
FT                   phosphate transporter"
FT                   /db_xref="GI:258510072"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="GeneID:8423515"
FT                   /translation="MSVLLAYALLAIFAALSGLNDGGNLLAVLSSSRILPVAVVIAEMG
FT                   TCMLAAPFLVGTRVAHTIGAGILPLPELSLPVVTAALVATLVTLAACYLSNVPTSITFA
FT                   LVGAMGGVGAVMLGMNRVHWASVGRVAGSLVMSVVLAGAAGYAAHFAARVLLGRVSARA
FT                   GRAALWTEIATSACVCIGYGANDAEKTLGLLALVTGVSHHHGTFHVAPWMVGFSTAAFL
FT                   VGLLVGGWRVARTIQGHVFRIRPIHAVMNEFATAAVVIAASSLGGPVSTTQALDSSLVG
FT                   VGASAHARRVRWRVVRKMAGVWLMTMPLAFLVGCVTGQLFVWGGYR"
FT                   /protein_id="YP_003183506.1"
FT   misc_feature    67390..68280
FT                   /note="Phosphate transporter family; Region: PHO4; cl00396"
FT                   /db_xref="CDD:153743"
FT                   /locus_tag="Aaci_0053"
FT   gene            68319..68954
FT                   /db_xref="GeneID:8423516"
FT                   /locus_tag="Aaci_0054"
FT   CDS_pept        68319..68954
FT                   /locus_tag="Aaci_0054"
FT                   /gene_family="HOG000101079" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /codon_start="1"
FT                   /product="Putitive phosphate transport regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   dar:Daro_0678 phosphate transport regulator- like protein"
FT                   /db_xref="GI:258510073"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="GeneID:8423516"
FT                   /translation="MSKLAQWLRPHESRFFALLEAQARQAQRGVHLLGEIVEMKPGEAE
FT                   LRRYAERMRVLEQEGDAIRRNVIEELIRSFMTPMDREDIYDLSRSLDDILDYAHTTVQE
FT                   FLVYAIPFEPAIHEMAGALKEGVDALAEAVAGLVKPGPSVHAAIVRAKKMENRMEELYR
FT                   ESNAELFLSQDVHHIFRMREVYRHLSNAADRLDRAADMVGSILIKGLG"
FT                   /protein_id="YP_003183507.1"
FT   misc_feature    68340..68942
FT                   /note="Phosphate transport regulator (distant homolog of
FT                   PhoU) [Inorganic ion transport and metabolism]; Region:
FT                   COG1392"
FT                   /db_xref="CDD:31582"
FT                   /locus_tag="Aaci_0054"
FT   gene            69155..70660
FT                   /db_xref="GeneID:8423517"
FT                   /locus_tag="Aaci_0055"
FT   CDS_pept        69155..70660
FT                   /locus_tag="Aaci_0055"
FT                   /gene_family="HOG000222134" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /codon_start="1"
FT                   /product="glycerol kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; KEGG: hha:Hhal_0078 glycerol kinase"
FT                   /db_xref="GI:258510074"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="GeneID:8423517"
FT                   /translation="MDARTFILAFDQGTTSSRAILFDRAGRIHSIAQKEFTQIYPKPGW
FT                   VEHDPMEIWGTQSGVAREVLEKAAVSPEQVAAIGITNQRETTVVWDKETGKPVYNAIVW
FT                   QDRRTADICDELKAAGHADAIRDKTGLVIDAYFSGTKIKWILDHVEGARERAERGELLF
FT                   GTIDTWLVWNLTRGKVHVTDYTNASRTMLFNIHTLDWDDDLLKLLGIPRAMLPEVRPSS
FT                   SIYGHTDEHTFGGANIPIAGIAGDQQAALFGQTCFEPGMVKNTYGTGCFMLMNTGEKPV
FT                   ASPSGLLTTIAWGLDGKVTYALEGSVFIAGAAIQWLRDGLRFFDAAADSEYFASKVEDT
FT                   GGVYVVPAFAGLGAPYWDMYARGAIFGLTRGTRKEHIIRATLDSLAYQTKDILDAMQRD
FT                   SGIELKSLRVDGGAVANNLLMQFQADILGVPVERPRITESTALGAAYLAGLAVGFWSKD
FT                   EIARSGDIERRFDPQMDAETRARLYRGWQRAVERTMGWAQEDI"
FT                   /protein_id="YP_003183508.1"
FT   misc_feature    69155..70645
FT                   /note="glycerol kinase; Provisional; Region: glpK;
FT                   PRK00047"
FT                   /db_xref="CDD:166745"
FT                   /locus_tag="Aaci_0055"
FT   misc_feature    69170..69913
FT                   /note="FGGY family of carbohydrate kinases, N-terminal
FT                   domain; Region: FGGY_N; pfam00370"
FT                   /db_xref="CDD:144091"
FT                   /locus_tag="Aaci_0055"
FT   misc_feature    69938..70474
FT                   /note="FGGY family of carbohydrate kinases, C-terminal
FT                   domain; Region: FGGY_C; pfam02782"
FT                   /db_xref="CDD:145766"
FT                   /locus_tag="Aaci_0055"
FT   gene            70814..72508
FT                   /db_xref="GeneID:8423518"
FT                   /locus_tag="Aaci_0056"
FT   CDS_pept        70814..72508
FT                   /locus_tag="Aaci_0056"
FT                   /gene_family="HOG000004812" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mxa:MXAN_7329 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="GI:258510075"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:8423518"
FT                   /translation="MAEGRFSIAARSAIKAEMAGEPLDLLIIGGGITGAGILLDATARG
FT                   MKAALVEMQDFAAGTSNRSTKLVHGGLRYLKQFEVGLVAEVGKERAIVYENGPHITTPV
FT                   WMLLPIIEGGTYGWLATSVGIYIYDKLAGVKRSERRKMLSAEQALEIEPLLRREGLKGA
FT                   GYYVEYRTDDARLTLEILKKAVEMSGLALNYAKATGFLYDHGRVAGAEVEDVLSGETFI
FT                   VRAKKVVNATGPWVDELREKDGSKSGKTLHHTKGVHIVVDGKRFPLRNSVYFDVPDGRM
FT                   VFAIPRDGKTYIGTTDTDYHGDLVHPRMTKADRDYLIDCVNSMFPSVKLTAADIESSWA
FT                   GVRPLIHEEGKDPSEISRKDEVFVSPSGLLTIAGGKLTGYRKMAEKVVDMVARDLAEDG
FT                   RRFGPCTTDKIPYSGGDFGGSDKMPAFVEDRVQRGVKLGLAEEDARRLARRYGTNVDLV
FT                   FNLLASGRDRAEAHGLRLDVYAELEYGLRHEMVATPSDFFIRRTGALYFDIDWVRENQN
FT                   AVIRYMAAACGWSEEETERHARELQARVLEATTVEEDIPASGNLVGA"
FT                   /protein_id="YP_003183509.1"
FT   misc_feature    70940..72457
FT                   /note="Glycerol-3-phosphate dehydrogenase [Energy
FT                   production and conversion]; Region: GlpA; COG0578"
FT                   /db_xref="CDD:30923"
FT                   /locus_tag="Aaci_0056"
FT   misc_feature    <71240..71845
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Aaci_0056"
FT   gene            72699..74579
FT                   /db_xref="GeneID:8423519"
FT                   /locus_tag="Aaci_0057"
FT   CDS_pept        72699..74579
FT                   /locus_tag="Aaci_0057"
FT                   /gene_family="HOG000086348" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09286"
FT                   /codon_start="1"
FT                   /product="Peptidase S53 propeptide"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidase S53 propeptide; peptidase S8 and S53
FT                   subtilisin kexin sedolisin; KEGG: cvi:CV_3519 periplasmic
FT                   aspartyl protease"
FT                   /db_xref="GI:258510076"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="GeneID:8423519"
FT                   /translation="MGLWKRLAFGLPAALGMLAVGVPTMDADAVQAAPLANPSTENAQD
FT                   LGPANASQTVTASVILHVQNPTALQNYIQQTETPGSAQYHKFLTTSQFAAQFAPSDQTI
FT                   QQIEQELEQYGLQVVNVSADHLDLQVQGTIQQFDHAFNTVIDLFKANGQVFRAPKKPPQ
FT                   IPVALLTNVLAVVGLDTANAAQSLTVKTPHVSGMPSPKAVLPQGGSTATGTPGSYTVGD
FT                   TANRYDVNPLYQKGITGKGETVGIVTLSSFNPQDAYTYWKGIGLHVAQNRIQMVNVDGG
FT                   GQMDDGSVETALDVEQAGGIAPDANVVVYDAPNTDQGFIDAFYQAVSDNQVDSLSVSWG
FT                   QPEIDYLPQMNQGQSYVDELLAFTQAFMEAAAQGISVYAAAGDSGAYDTARDFPPSQGF
FT                   STPLTVDFPASDPFVTAAGGTTVPFSATFSLGKVNITQEQPWSWQYLQNLGYQGLFPIG
FT                   TGGGVSVIFPRPWYQNGVSGVQNSAANQAFTDSQGVLYGSPFTYNLPSNYPGRNLPDVS
FT                   MDADPETGYLVYWSAGGGWLAGYGGTSFVAPQLNGITALIDQYVGGRVGFLDPVFYQLM
FT                   QQNGYGANQPFNDLTTGNNWYWSAVPGYDRASGIGTPNVANLAQAIKSMG"
FT                   /protein_id="YP_003183510.1"
FT   misc_feature    72819..73235
FT                   /note="Pro-kumamolisin, activation domain; Region:
FT                   Pro-kuma_activ; pfam09286"
FT                   /db_xref="CDD:150076"
FT                   /locus_tag="Aaci_0057"
FT   misc_feature    73347..74555
FT                   /note="Peptidase domain in the S53 family; Region:
FT                   Peptidases_S53; cd04056"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Aaci_0057"
FT   misc_feature    order(73566..73568,73578..73580,73710..73721,73836..73838,
FT                   73842..73847,74328..74330)
FT                   /note="active site"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Aaci_0057"
FT   misc_feature    order(73566..73568,73578..73580,74328..74330)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Aaci_0057"
FT   misc_feature    order(74463..74468,74499..74501,74511..74513)
FT                   /note="calcium binding site; other site"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Aaci_0057"
FT   gene            74711..75415
FT                   /db_xref="GeneID:8423520"
FT                   /locus_tag="Aaci_0058"
FT   CDS_pept        74711..75415
FT                   /locus_tag="Aaci_0058"
FT                   /gene_family="HOG000273994" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: sde:Sde_1768
FT                   GntR family transcriptional regulator"
FT                   /db_xref="GI:258510077"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:8423520"
FT                   /translation="MIAGVTYGVAKKTLGEQAYEVIREEILSLRLHPGQTVYESDFTRM
FT                   LNMSRTPVREAVRALAMERLIEVLPQRGMKVALISERQVEETRFVRESLELSVIRRVAE
FT                   DVAQDASVRARLEREMARSLQDQREAAEAGDALQFMHADDAFHQIFLQHFDNETLTAIV
FT                   AQMRGHLNRVRMLSLFEPERMKRLVGEHERVAEAVLSGNADRSAEAMHHHLAKLMEDLP
FT                   GIKARHPAFFGP"
FT                   /protein_id="YP_003183511.1"
FT   misc_feature    74738..75406
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   GntR; COG1802"
FT                   /db_xref="CDD:31987"
FT                   /locus_tag="Aaci_0058"
FT   misc_feature    74747..74941
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Aaci_0058"
FT   misc_feature    order(74747..74749,74753..74755,74822..74824,74825..74830,
FT                   74852..74866,74870..74875,74882..74884,74912..74917,
FT                   74921..74932)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Aaci_0058"
FT   misc_feature    74978..75355
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="Aaci_0058"
FT   gene            75440..76207
FT                   /db_xref="GeneID:8423521"
FT                   /locus_tag="Aaci_0059"
FT   CDS_pept        75440..76207
FT                   /locus_tag="Aaci_0059"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   sde:Sde_1283 2-deoxy-D-gluconate 3- dehydrogenase"
FT                   /db_xref="GI:258510078"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002424"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:8423521"
FT                   /translation="MRLQDKVALVTGGGRGIGAAIARRFAQEGADVCLVSRTEAELEAQ
FT                   AQWIASQTGRAALPVVCDVSNPADVERAVAAAEERFGRIDILVNAAGISVAAPSTDLSF
FT                   DRWKACLNINLDGTFLFCQAVGRGMIARGQGGKIINITSVVAHAGIPERATYAASKGGV
FT                   RQLTQALAVEWAKHNIQVNAISPGFIMTEIVRDYIRRGIHKPEKLVARIPAGRMGQPDD
FT                   IAGPAVFLASSDSDYVTGTILIADGGFLANGYV"
FT                   /protein_id="YP_003183512.1"
FT   misc_feature    75440..76183
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Aaci_0059"
FT   misc_feature    75440..76183
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="Aaci_0059"
FT   gene            76219..78291
FT                   /db_xref="GeneID:8423522"
FT                   /locus_tag="Aaci_0060"
FT   CDS_pept        76219..78291
FT                   /locus_tag="Aaci_0060"
FT                   /gene_family="HOG000177796" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.1.139"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.139"
FT                   /transl_table="11"
FT                   /note="PFAM: Glycosyl hydrolase 67 middle domain protein;
FT                   glycosyl hydrolase 67 C-teriminal domain protein; KEGG:
FT                   hypothetical protein ; K01235 alpha- glucuronidase"
FT                   /db_xref="GI:258510079"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="GeneID:8423522"
FT                   /translation="MTNIPEGDLDYRAWLQESPLPRAVPEAARRMAVYGPADDPLLCTA
FT                   AAEWGRAVRAACGESPARLARDPGGAPSVPCVAMGLLSAMPRGLREAAQAALAGAPSDE
FT                   AYAILPVDGQGVAVVSRTPAGVLYGVFHLIRRLRLGEPLHEPCVSSPKNAWRMLDHWDN
FT                   ADGTIERGYAGKSLFYRGGQIDFDEGRVRDYARLLASVGVNAIAINNVNVHETETRFLT
FT                   EAHLPGVARLADVFRPYGIRVFLSINFASPVDLGDLPTADPLDPRVEDWWRATADRIYR
FT                   HIPDFGGFLVKADSEFRPGPFTYGRDHADGANMLARALAPHGGVVIWRAFVYNCLMDWR
FT                   DRRADRARAAYDHFVPLDGRFLDNVLIQIKNGPMDFQVREPVSPLFGGLSATNVMLEFQ
FT                   ITQEYTGQQRHVCYLAPMWKEVLDFDTHARGPGSTVAEIASGRLFGRPHGGVAGVANVG
FT                   DDVNWTGHSLAQANLYAFGRLAWDPSLDPAGIAREWARLTYGDDPDVVRTVVGILMASW
FT                   PAYEAYTAPLGVGWMVNPGHHDGPNPEGYEYSKWGTYHYADWRGVGVDRTMATGTGYTG
FT                   QYHEPMRSLYEHLETCPDELLLFFHHVPYTHVLHSGKTVIQHIYDAHFDGVEAVAWMIE
FT                   AWRRLQGRIDPVRFERVLARLEDQMQRAVEWRDVINTYFYRKCGIPDARGLHIYP"
FT                   /product="Alpha-glucuronidase"
FT                   /protein_id="YP_003183513.1"
FT   misc_feature    76237..78288
FT                   /note="Alpha-glucuronidase [Carbohydrate transport and
FT                   metabolism]; Region: AguA; COG3661"
FT                   /db_xref="CDD:33459"
FT                   /locus_tag="Aaci_0060"
FT   misc_feature    77608..78285
FT                   /note="Glycosyl hydrolase family 67 C-terminus; Region:
FT                   Glyco_hydro_67C; pfam07477"
FT                   /db_xref="CDD:148850"
FT                   /locus_tag="Aaci_0060"
FT   gene            78354..79016
FT                   /db_xref="GeneID:8423523"
FT                   /locus_tag="Aaci_0061"
FT   CDS_pept        78354..79016
FT                   /locus_tag="Aaci_0061"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pnap_4852"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_4852 hypothetical protein"
FT                   /db_xref="GI:258510080"
FT                   /db_xref="GeneID:8423523"
FT                   /translation="MASSRTRKRLGWVGGAVFLAAALYVVYMAYASFIADPGDVSFLAH
FT                   KTSLHRHLSHGAWLVALHVHVASALVAILAGALNFGWTRARAHPVLHRAVGYLYLAGVL
FT                   GVDGTSGYLAPEATGGEVVTVAFNLLNVYWLVAAFWVYWMARKRRPDAHRRWAVRSYVF
FT                   LDTNALNRGFTWLSVHVAGLPFATAYTMAVCLSIAMNVALGEVLARTLYPCTSARRA"
FT                   /protein_id="YP_003183514.1"
FT   misc_feature    78606..>78842
FT                   /note="Predicted membrane protein (DUF2306); Region:
FT                   DUF2306; cl02232"
FT                   /db_xref="CDD:154810"
FT                   /locus_tag="Aaci_0061"
FT   gene            complement(79091..80602)
FT                   /db_xref="GeneID:8423524"
FT                   /locus_tag="Aaci_0062"
FT   CDS_pept        complement(79091..80602)
FT                   /locus_tag="Aaci_0062"
FT                   /gene_family="HOG000262983" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /codon_start="1"
FT                   /product="Na+/solute symporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bcm:Bcenmc03_2360
FT                   Na+/solute symporter"
FT                   /db_xref="GI:258510081"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="GeneID:8423524"
FT                   /translation="MQINWTAFSIFIIFFLFVAVLGFVAARWRRGDLSHLEEWGLAGRR
FT                   FGTLITWFLVGGDLYTAYTFIAVPGLMYGKGALGFYAVPYTTVVYPIFLLILPRFWSVA
FT                   RSKGYVTASDFVQGRYGDRLLSFAVALTGIVATIPYIALQLTGMQAVITAMGIPGSWPL
FT                   IIAFIILALFAYTSGLRAPAMIAIVKDLMIYITIIVAVILIPIKLGGFGPIFHASAAAL
FT                   AKHHPPGSIALSPKLYATYGTLALGSALALFLYPHAVTGVFSASSRRVVKRNMALLPAY
FT                   SFALGIIALLGYMALAAGVHTKSTSEAVPLLFLKEFPTWFAGFGFAAIGIGALVPAAIM
FT                   SIASANLFTRNIYKAFFVPNASHENEARVAKIVSLIIILLALVFILGFPQQYAISMQQV
FT                   GGILILQTLPTVVFGLFTRWFHRRGLFLGWLVGIVLGVLMWASTGYQSTSYTVGGVTAY
FT                   AGIWALIVNIVIAVVFSAIFRAMGLSNGEDETSPSDYRVDVEASA"
FT                   /protein_id="YP_003183515.1"
FT   misc_feature    complement(79163..80524)
FT                   /note="Sodium:solute symporter family; Region: SSF;
FT                   cl00456"
FT                   /db_xref="CDD:174215"
FT                   /locus_tag="Aaci_0062"
FT   misc_feature    complement(79172..80521)
FT                   /note="Predicted symporter [General function prediction
FT                   only]; Region: DhlC; COG4147"
FT                   /db_xref="CDD:33899"
FT                   /locus_tag="Aaci_0062"
FT   gene            complement(80621..80833)
FT                   /db_xref="GeneID:8423525"
FT                   /locus_tag="Aaci_0063"
FT   CDS_pept        complement(80621..80833)
FT                   /locus_tag="Aaci_0063"
FT                   /gene_family="HOG000262994" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_2428"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_2428 hypothetical protein"
FT                   /db_xref="GI:258510082"
FT                   /db_xref="GeneID:8423525"
FT                   /translation="MNDTQKPSTKAKRWWYLLILAPVIGSLFPGLYGSLKPELWGIPYF
FT                   YWYQMLWIIIAAIITAFLYNILKDD"
FT                   /protein_id="YP_003183516.1"
FT   misc_feature    complement(80627..80785)
FT                   /note="Protein of unknown function (DUF3311); Region:
FT                   DUF3311; pfam11755"
FT                   /db_xref="CDD:152191"
FT                   /locus_tag="Aaci_0063"
FT   gene            complement(81071..82765)
FT                   /db_xref="GeneID:8423526"
FT                   /locus_tag="Aaci_0064"
FT   CDS_pept        complement(81071..82765)
FT                   /locus_tag="Aaci_0064"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: dma:DMR_19620 sensor protein ZraS; TIGRFAM:
FT                   PAS sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; PAS fold domain protein; PAS fold-4 domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein"
FT                   /db_xref="GI:258510083"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:8423526"
FT                   /translation="MNHDFRRAYPYALLAIGLTVPFCAAWGLYGQTQSLLWILIAVACG
FT                   LEFFPLQLPGGRQWSTSVFCYVWAADQFGFWAASTTILFSVIAAFLRSVDGKLTGAHLR
FT                   RLLISLGTHQLALVPAYAALRHALFLPYLIRSALAAVLFELARLTALACFHGSMRRLGA
FT                   AFGALRGLHPAALLIPASLASLLSAHEADWAVTLPTAALFLSFLWLSRAHARLADECES
FT                   ARQTYRVIAENSADLVLIAAPSGEITFASPGFLASAGLSRESLVGRSVFDLVAPEDFAR
FT                   FDELFTPAGADGQEHDVALEIDDVRVNVALRLTLIRSGTHSPSYILQARDLAPRLRREA
FT                   SRLRDERLEAVGQLAASIAHEFRNPLTTVMGFVQLFRSQFDELAPGAYEAIWGELERMK
FT                   DVTDSLMVLARPEAFKPIPCDLAEMARAAIGACEPLALERGVPVDLGPLPPAQVLGHPG
FT                   QLRQMMVHLLRNAIEAAAETRGRVVLWVTSTEAEAIVHIQDTGPGIPDSVLEHLGEPLY
FT                   HTKEKGTGLGLMVVHRIVQQHGGQIHIRRTEAPIGTAVEVRLPISRR"
FT                   /protein_id="YP_003183517.1"
FT   misc_feature    complement(81077..82084)
FT                   /note="Signal transduction histidine kinase, nitrogen
FT                   specific [Signal transduction mechanisms]; Region: NtrB;
FT                   COG3852"
FT                   /db_xref="CDD:33642"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(81785..82066)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(order(81854..81856,81860..81862,81938..81949,
FT                   81986..81988,82004..82006,82016..82018))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(order(81827..81829,81833..81835,81908..81913,
FT                   81920..81922,81944..81946,81956..81958))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(81536..81724)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(order(81551..81553,81563..81565,81572..81574,
FT                   81584..81586,81593..81595,81605..81607,81650..81652,
FT                   81659..81661,81671..81673,81680..81682,81692..81694,
FT                   81704..81706))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(81686..81688)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(81089..81388)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(order(81101..81103,81107..81112,81125..81127,
FT                   81134..81136,81182..81193,81254..81259,81263..81265,
FT                   81269..81271,81275..81277,81347..81349,81356..81358,
FT                   81368..81370))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(81356..81358)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0064"
FT   misc_feature    complement(order(81185..81187,81191..81193,81257..81259,
FT                   81263..81265))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0064"
FT   gene            complement(83059..84255)
FT                   /db_xref="GeneID:8423527"
FT                   /locus_tag="Aaci_0065"
FT   CDS_pept        complement(83059..84255)
FT                   /locus_tag="Aaci_0065"
FT                   /gene_family="HOG000220178" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03469"
FT                   /codon_start="1"
FT                   /product="hopene-associated glycosyltransferase HpnB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: hopene-associated glycosyltransferase HpnB;
FT                   PFAM: glycosyl transferase family 2; KEGG:
FT                   bpd:BURPS668_A3051 glycosyl transferase, group 2 family
FT                   protein"
FT                   /db_xref="GI:258510084"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR017832"
FT                   /db_xref="GeneID:8423527"
FT                   /translation="MTALAWAAAVSLAAWIFLLFGRGFYWRTALSMNTARMAAEARAPR
FT                   AWPAVWAVVPARNEADVLPRTLPTLLSQAYPGEFHVVLVDDHSTDGTAEVAERLASELR
FT                   LAHRLRVVRADALPPGWAGKVWAMQNGLRHVPDDAAYVLFTDADISHSPTSVQALVARA
FT                   ERDGLDLVSLMVRLRAESAWEKLLIPAFVYFFAKLYPFAWVAHPRRRTAAAAGGCVLVR
FT                   RRLLPTPPGLEAIRDAVIDDCALARLVADGGGRLWLGLGDDVVSVRAYGTLGEIWRMIA
FT                   RTAFVQLRFSTVLLLGTALGMLLLYAVPPAAAIAGLVGLLAGAPGSLAALCLGGLAYAI
FT                   LASTFVPMLRWYRLSPARSALLPLAGVLYTLMTLDSARRFWLRTGDHWKGRPYEMRRP"
FT                   /protein_id="YP_003183518.1"
FT   misc_feature    complement(83077..84210)
FT                   /note="hopene-associated glycosyltransferase HpnB; Region:
FT                   HonB; TIGR03469"
FT                   /db_xref="CDD:132509"
FT                   /locus_tag="Aaci_0065"
FT   misc_feature    complement(<83743..84084)
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:176938"
FT                   /locus_tag="Aaci_0065"
FT   misc_feature    complement(order(83812..83814,83818..83820,84004..84006))
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Aaci_0065"
FT   gene            84370..85158
FT                   /db_xref="GeneID:8423528"
FT                   /locus_tag="Aaci_0066"
FT   CDS_pept        84370..85158
FT                   /locus_tag="Aaci_0066"
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03263"
FT                   /codon_start="1"
FT                   /EC_number="2.7.4.8"
FT                   /transl_table="11"
FT                   /note="KEGG: pfs:PFLU5993 guanylate kinase; TIGRFAM:
FT                   guanylate kinase; PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region"
FT                   /db_xref="GI:258510085"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="GeneID:8423528"
FT                   /translation="MSQIRFHLDRLLSERNWKIPDLVKRSGVNKNTLYAMKKNAITRVD
FT                   LRVLERICDALSCKLSDLMTYEPEGETHTKGLLFILSGPSGAGKNTLINALRDRYDLGL
FT                   TFIPSFSTRPMRPGETNGNPYYFVSREEFMRMAERGEFLEYETIHGNLYGTHLLSYERA
FT                   LNEGRIIIKDIDVNGALNMKRVFGDRVILIYVRPTCLDDLEGRLHHRGDKEEDIRIRMQ
FT                   RLKYEESLSDQFDFLIFNDDVATATAELAHIIRTCTRKHA"
FT                   /product="transcriptional regulator, XRE family"
FT                   /protein_id="YP_003183519.1"
FT   misc_feature    84379..84585
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="Aaci_0066"
FT   misc_feature    84601..85119
FT                   /note="Guanosine monophosphate kinase (GMPK, EC 2.7.4.8),
FT                   also known as guanylate kinase (GKase), catalyzes the
FT                   reversible phosphoryl transfer from adenosine triphosphate
FT                   (ATP) to guanosine monophosphate (GMP) to yield adenosine
FT                   diphosphate (ADP) and...; Region: GMPK; cd00071"
FT                   /db_xref="CDD:73180"
FT                   /locus_tag="Aaci_0066"
FT   misc_feature    order(84616..84618,84634..84636,84685..84687,84706..84708,
FT                   84715..84717,84742..84744,84811..84813,84826..84828)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:73180"
FT                   /locus_tag="Aaci_0066"
FT   misc_feature    order(84616..84618,84634..84636)
FT                   /note="G-X2-G-X-G-K; other site"
FT                   /db_xref="CDD:73180"
FT                   /locus_tag="Aaci_0066"
FT   gene            85171..87126
FT                   /db_xref="GeneID:8423529"
FT                   /locus_tag="Aaci_0067"
FT   CDS_pept        85171..87126
FT                   /locus_tag="Aaci_0067"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   afw:Anae109_0620 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="GI:258510086"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:8423529"
FT                   /translation="MQVNAHPRVRFSLRYKIIAILFGAMLVVLALGGTLFYSVARQQML
FT                   KSADKQAQLLAQQIELEVESSEAGQAYIDNLLGNELRIASIAIEKQLPPHWRDVTNEQL
FT                   RQLSAELGVSGITLLAPTADDIVGVRSSDPREIGLSTRGMGKWYIAFRDLLAGRPQAST
FT                   YGTAGKNYWSGPFANAASDPSKVDKWGYYYDGTTDYIIDPFYVQTSIPGYEQVVSVNST
FT                   IRHILATEPDILSIAVLNRTFDEKPIRYSYKGVSWIDIANQPVMYGAYRYADHDLDVRL
FT                   KDRALSTGHMQTALDHVDGTTVMKAFIPESEQGSRYIVEIVMNYRIITAQLGDLLHDMA
FT                   ILGGALLVLTGVLSFVGAELITRPLKRITEAVDEIADRNFAAHVDVARSDEIGVLAAHV
FT                   NEMSEKLVEYLRELTRRERGRGVDYLVMATQALVHELGTPLAAIRQMSELLPRLEPNLG
FT                   EKAREILERMRSASEYANRIARDFTAFLRNGMLTVRRRDVVRLVSDAVGLCSSMAQARH
FT                   VKLSFRNETGHRHVYLDVDEDKLFGAIVNLVRNAIDAIPDDRARREVDVTVRIEAEELH
FT                   IDVIDSGVGIPRDRWDRIFVPYSSTKKGGLGLGLTFCGLIAIAHGGTVGVVQSSPQGTH
FT                   IRMRLPLKHEPIQVDA"
FT                   /protein_id="YP_003183520.1"
FT   misc_feature    86251..86394
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cd06225"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Aaci_0067"
FT   misc_feature    order(86251..86256,86263..86268,86272..86277,86284..86289,
FT                   86293..86295,86341..86346,86350..86355,86362..86367,
FT                   86371..86376,86383..86388)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Aaci_0067"
FT   misc_feature    86455..86631
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Aaci_0067"
FT   misc_feature    order(86464..86466,86476..86478,86485..86487,86497..86499,
FT                   86506..86508,86560..86562,86572..86574,86581..86583,
FT                   86593..86595,86602..86604,86614..86616)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Aaci_0067"
FT   misc_feature    86470..86472
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Aaci_0067"
FT   misc_feature    86788..87090
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0067"
FT   misc_feature    order(86806..86808,86818..86820,86827..86829,86905..86907,
FT                   86911..86913,86917..86919,86923..86928,86989..87000,
FT                   87046..87048,87052..87054,87067..87072,87076..87078)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0067"
FT   misc_feature    86818..86820
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0067"
FT   misc_feature    order(86917..86919,86923..86925,86989..86991,86995..86997)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aaci_0067"
FT   gene            complement(87111..88232)
FT                   /db_xref="GeneID:8423530"
FT                   /locus_tag="Aaci_0068"
FT   CDS_pept        complement(87111..88232)
FT                   /locus_tag="Aaci_0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /codon_start="1"
FT                   /product="transglutaminase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transglutaminase domain protein; Protein of
FT                   unknown function DUF553; SMART: transglutaminase domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="GI:258510087"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR007562"
FT                   /db_xref="GeneID:8423530"
FT                   /translation="MNDWLEWVLWAIVAVSALAGFRRGFERESRRLVQTAAFVAEVVAS
FT                   SAAAFAASRSIRNFVLQDSQSASVPSWLAHLAAFWQQSPRLCNWIAFLAAYLVVSSAIG
FT                   ALLAPLGARWIRPRGRMRALSRAGGLVVGGVLGAFRAAAVGACLFLVLQYVSAPALARA
FT                   SQASPAYRWLSHHVYTPWLRPIAEREMPVLAKGAAQTVAADISLFVVPTGPGEETGILV
FT                   VPKPVAEKALAITSGLTSPYAKARALYEWEIDHVHYDWKKYDDYVDDGKWDAQSPLTTL
FT                   ETGKGVCADYALLYADMAHAVGLTVRIDEGVAVTGGVEGSHAWNEVWIPDQHRYILVDP
FT                   TWGSAQDAWFDVPPAVFDETHRLTTRITIYAST"
FT                   /protein_id="YP_003183521.1"
FT   misc_feature    complement(87213..87542)
FT                   /note="Transglutaminase-like superfamily; Region:
FT                   Transglut_core; cl10469"
FT                   /db_xref="CDD:176834"
FT                   /locus_tag="Aaci_0068"
FT   gene            88321..89253
FT                   /db_xref="GeneID:8423531"
FT                   /locus_tag="Aaci_0069"
FT   CDS_pept        88321..89253
FT                   /locus_tag="Aaci_0069"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pae:PA5031 putative short chain
FT                   dehydrogenase"
FT                   /db_xref="GI:258510088"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:8423531"
FT                   /translation="MAWTADQIPNLKGKWAVITGANSGIGWQAARALARRRARVTLAVR
FT                   NRERGEDAKARILAEVQSAEIDVRLLDLADLDSVRSFAEALVAEGKPLDLLINNAGVMA
FT                   TSYGTTRQGYELQFGTNHLGHFALTLQLLPILAGTTGARVVTVSSMAHQMAKHLDLAYV
FT                   RGGGRYRRFESYAQSKLANLLFAYELDRRLKRRGLPLKSIACHPGFAATSLVENGMLKS
FT                   AWAKPLARIVNRFAQPSEMGALPTLYAATHPDLEGGEYVGPDRGSRGYPVVVSSSPASR
FT                   DLAAARELWSASLEMTGIPRDAWYALEDE"
FT                   /protein_id="YP_003183522.1"
FT   misc_feature    88327..89217
FT                   /note="short chain dehydrogenase; Provisional; Region:
FT                   PRK06197"
FT                   /db_xref="CDD:168457"
FT                   /locus_tag="Aaci_0069"
FT   misc_feature    88342..89220
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Aaci_0069"
FT   gene            89298..89894
FT                   /db_xref="GeneID:8423532"
FT                   /locus_tag="Aaci_0070"
FT   CDS_pept        89298..89894
FT                   /locus_tag="Aaci_0070"
FT                   /gene_family="HOG000076391" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.1.21"
FT                   /codon_start="1"
FT                   /EC_number="2.7.1.21"
FT                   /transl_table="11"
FT                   /note="PFAM: thymidine kinase; KEGG: sei:SPC_1979 thymidine
FT                   kinase"
FT                   /db_xref="GI:258510089"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="GeneID:8423532"
FT                   /translation="MAKLYFRFGQMNASKSIQLLTVAHSYEEQGKKVALFTPAIDDRYG
FT                   RGVIASRVGIAKRAVVVEEDTDLFACVRAQMPDCVLVDEVQFLRAYHVRQLARVADDLD
FT                   IPVIMYGLLKDYRNRLFEGSEAAILWADRIEEIKTICAHPGCDRKATMILKVKDGRPVY
FT                   EGEQIEVGGNDLYKSVCRKHYFHPDVEGLMRATGP"
FT                   /product="Thymidine kinase"
FT                   /protein_id="YP_003183523.1"
FT   misc_feature    89298..89861
FT                   /note="Thymidine kinase; Region: TK; cl00631"
FT                   /db_xref="CDD:174319"
FT                   /locus_tag="Aaci_0070"
FT   gene            complement(89934..90287)
FT                   /db_xref="GeneID:8423533"
FT                   /locus_tag="Aaci_0071"
FT   CDS_pept        complement(89934..90287)
FT                   /locus_tag="Aaci_0071"
FT                   /gene_family="HOG000221987" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_1600 hypothetical protein"
FT                   /db_xref="GI:258510090"
FT                   /db_xref="GeneID:8423533"
FT                   /translation="MKCIYLSGPMTGLPHGNRPAFLEAAQSLRARGFRVINPAEYGSPE
FT                   DDWYAAMRRDIRMLMDADAVVTLPGWERSRGARLEVYVACQLNMPVYTLTACLRAAEED
FT                   LAKAPAIQLSLEL"
FT                   /protein_id="YP_003183524.1"
FT   misc_feature    complement(89976..90278)
FT                   /note="Nucleoside 2-deoxyribosyltransferase; Region:
FT                   Nuc_deoxyrib_tr; cl01450"
FT                   /db_xref="CDD:154407"
FT                   /locus_tag="Aaci_0071"
FT   gene            90462..91889
FT                   /db_xref="GeneID:8423534"
FT                   /locus_tag="Aaci_0072"
FT   CDS_pept        90462..91889
FT                   /locus_tag="Aaci_0072"
FT                   /gene_family="HOG000229886" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; KEGG: sat:SYN_02917 FAD-dependent dehydrogenase"
FT                   /db_xref="GI:258510091"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:8423534"
FT                   /translation="MAEQYDVIIVGAGPAGLYAAYELVEKAPKLKVLLIDKGVEARFRH
FT                   CPIMEGRIDKCPPPNKIKTYASCWPACGVINGAGGAGSFSDGKFNITAEYGGYLTEYLP
FT                   ASEVLGLIEYVDAINLRHGAPDAVTDPSTPAVAAIERRAMAAGLKLLRARVRHIGTDKN
FT                   LELIQSLFEHLGRHIDLRFRTFVEDIVVEGDRVGGVILRGGEIIRSRYVLLAPGRDGAT
FT                   WLSDLFRRHKLKMTNNQVDIGVRVETSNVVMQELNEHLYEAKFLFQSPATGLMVRTFCA
FT                   NPSGHVVIENHTGVMAANGHAYHDPALGSQNTNFALLVSHRFTEPFDKPNEFAKSICRH
FT                   ANELSNGSIILQKYGDLRKGRRSTPQRIREGFVEPTLKEAVPGDLGLVLPYKTMVALME
FT                   MVEALDKVAPGVASDHTLFYGVEAKFYAARAEVGPDLQTKIDGLYCAGDGPGISRGISQ
FT                   AASCGVHVARQIAKRET"
FT                   /protein_id="YP_003183525.1"
FT   misc_feature    90462..91880
FT                   /note="Uncharacterized FAD-dependent dehydrogenases
FT                   [General function prediction only]; Region: COG2509"
FT                   /db_xref="CDD:32579"
FT                   /locus_tag="Aaci_0072"
FT   misc_feature    90462..>90569
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Aaci_0072"
FT   gene            complement(91972..93264)
FT                   /db_xref="GeneID:8423535"
FT                   /locus_tag="Aaci_0073"
FT   CDS_pept        complement(91972..93264)
FT                   /locus_tag="Aaci_0073"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /codon_start="1"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /transl_table="11"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: afr:AFE_1028
FT                   hypothetical protein"
FT                   /db_xref="GI:258510092"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:8423535"
FT                   /translation="MRVNKGRLRLRLAAAVAPALLFMTACGQANVSPQRATAGASPQGA
FT                   ATGAAPSPANESASIAASASQFTWIGEPGAGSAPWVSAIERARQRVDYNVYLLTDENVA
FT                   NALKQAAARGVAVRLILDSHPYDFPDAVSKELAMFRGSKVQVKTWSPSATSYDHAKYLV
FT                   VDGRVAIVGSANATYSALDGGANLEDNVEIDGGTLPADLDALFEADWAGRPRPSLPPAL
FT                   IVSPGSSKALADQIRQPGPVMMAEEELYDAPDVMAAMEAKGRQLELLLPSSIDSEEMAN
FT                   ARMLAGHGVQVRLLSSPYVHAKLIAGTEAVFVGSENLSANSLDDNREVGIAVTQPLVRA
FT                   QAQAWFAQYWQKAQPLSSASGTSGGGASTGSGGAYPYLPLGISESEARAKWGPPSSISS
FT                   TTYHGRPETVWTYPNGARLYFQDGKLVHVSR"
FT                   /protein_id="YP_003183526.1"
FT   misc_feature    complement(92617..93027)
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Aaci_0073"
FT   misc_feature    complement(order(92701..92703,92740..92742,92746..92748,
FT                   92785..92787,92791..92793))
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Aaci_0073"
FT   misc_feature    complement(order(92740..92742,92746..92751,92770..92772,
FT                   92785..92787,92791..92793))
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Aaci_0073"
FT   misc_feature    complement(91975..92127)
FT                   /note="Protein of unknown function (DUF2845); Region:
FT                   DUF2845; pfam11006"
FT                   /db_xref="CDD:151453"
FT                   /locus_tag="Aaci_0073"
FT   gene            complement(93316..94089)
FT                   /db_xref="GeneID:8423536"
FT                   /locus_tag="Aaci_0074"
FT   CDS_pept        complement(93316..94089)
FT                   /locus_tag="Aaci_0074"
FT                   /gene_family="HOG000004695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /codon_start="1"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: rle:pRL120015 putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="GI:258510093"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="GeneID:8423536"
FT                   /translation="MIRELLMRDDTLFIAHRGASAECPENTLPAFVRAAELGADMIELD
FT                   VRLTGDGGVVVLHDPTVDRTTNGSGLAADMRLADLRKLDAGSWFDARFRGTLIPTLDEV
FT                   FATVPHMCLNIELKTSPVAHTRQLIRRVLGAIYRHNARDRVLISSFDHAALAEVRRFDR
FT                   DIAIGVLFTGRLLEPIQLAERLGAQSLHPDIEHLDPLFVAEAKSHHLAVYAWTAKSELA
FT                   VNRALACQVSGIILDDLRLRQIATKAVPSPTPPSA"
FT                   /protein_id="YP_003183527.1"
FT   misc_feature    complement(93379..94059)
FT                   /note="Glycerophosphodiester phosphodiesterase domain of
FT                   Thermoanaerobacter tengcongensis and similar proteins;
FT                   Region: GDPD_TtGDE_like; cd08563"
FT                   /db_xref="CDD:176506"
FT                   /locus_tag="Aaci_0074"
FT   misc_feature    complement(93376..94044)
FT                   /note="Glycerophosphoryl diester phosphodiesterase family;
FT                   Region: GDPD; pfam03009"
FT                   /db_xref="CDD:145909"
FT                   /locus_tag="Aaci_0074"
FT   misc_feature    complement(order(93445..93447,93580..93582,93640..93642,
FT                   93742..93744,93916..93918,93955..93957,93961..93963,
FT                   94042..94044))
FT                   /note="active site"
FT                   /db_xref="CDD:176506"
FT                   /locus_tag="Aaci_0074"
FT   misc_feature    complement(order(93916..93918,94042..94044))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:176506"
FT                   /locus_tag="Aaci_0074"
FT   misc_feature    complement(order(93742..93744,93916..93918,93955..93957,
FT                   93961..93963))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:176506"
FT                   /locus_tag="Aaci_0074"
FT   misc_feature    complement(order(93490..93492,93535..93540,93547..93552,
FT                   93562..93573,93622..93624,93631..93636,93640..93642,
FT                   93724..93726,93730..93732))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:176506"
FT                   /locus_tag="Aaci_0074"
FT   gene            complement(94121..95446)
FT                   /db_xref="GeneID:8423537"
FT                   /locus_tag="Aaci_0075"
FT   CDS_pept        complement(94121..95446)
FT                   /locus_tag="Aaci_0075"
FT                   /gene_family="HOG000227636" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: kpu:KP1_0565 putative sn-glycerol-3-phosphate-
FT                   binding periplasmic protein"
FT                   /db_xref="GI:258510094"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="GeneID:8423537"
FT                   /translation="MKRDRLWKSGALLALGLVATGCGAPAANGGGQAATGASRAAASSQ
FT                   PVTITFWYGVGTTLSQDIQQMVQAFNQTHPGIKVVATYQGSYSGGGEEQQKLLAAIKAG
FT                   DPPTIAQIEVHAMPVFAASGQLLDLTNLMQSSSVDKPSNFLPGILVSTQYQGRYYAVPF
FT                   NRSVPVLYYNKTLFAKAHIASPPSNWAQLAADAKKLTSGAGSNKIYGFEPLVDWWPWEY
FT                   AVESGGGSILSPDLKRATFDQPPALSILETEQSLVKQGYAKVETGPNYWDLMTQDFING
FT                   QVAMDIDSIGSAGKVTKGVGDKFQWGTALLPRGKTLAVPPGGGDLAIFKDATPAQQKAA
FT                   WTFIQWWTAPKQSVQWSTETGYLPVQKADLNDPVYQAYLEKHPQYRTAIEELQYEHPSP
FT                   ASPAYLAVLQPVQQALQGIFDEGKPVAATMHQAAEAADQNLG"
FT                   /protein_id="YP_003183528.1"
FT   misc_feature    complement(94250..95305)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Aaci_0075"
FT   gene            complement(95489..96316)
FT                   /db_xref="GeneID:8423538"
FT                   /locus_tag="Aaci_0076"
FT   CDS_pept        complement(95489..96316)
FT                   /locus_tag="Aaci_0076"
FT                   /gene_family="HOG000220525" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rpb:RPB_0175
FT                   binding-protein dependent transport system inner membrane
FT                   protein"
FT                   /db_xref="GI:258510095"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:8423538"
FT                   /translation="MKANPVLKIASYALLTIAAALCLAPVYWMIRTSLMPTNDLLSSAL
FT                   WPAHPAWSNFAAAWRAQPFLLYLWNSVFTNGAIVALQVITSSLAAYALVFIPLRGKRWL
FT                   FFAVLVAMMVPMQATFVPVYTMLSAVHLINTYGALILPYAGSAFGIFLMRQGFLTLPRD
FT                   IVDAARVDGASEWWILTRIVLPNNKPTIVTLVLLNFVYHYNSLFWPLVATNTTNMRVVP
FT                   VALSYFLTQDAGQTLQWNYAMAFDIFAIAPVVILFLIGQRYFVQGVAQTAVKG"
FT                   /protein_id="YP_003183529.1"
FT   misc_feature    complement(95555..96115)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0076"
FT   misc_feature    complement(order(95555..95560,95567..95572,95579..95584,
FT                   95588..95593,95600..95605,95633..95638,95684..95689,
FT                   95696..95707,95726..95728,95735..95740,95780..95782,
FT                   95831..95833,95840..95845,95855..95857,95861..95866,
FT                   95873..95875,95879..95881,95885..95890,95945..95947,
FT                   95951..95956,95963..95992,95996..96007,96035..96037,
FT                   96050..96055,96062..96067))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0076"
FT   misc_feature    complement(order(95690..95707,95945..95989))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0076"
FT   misc_feature    complement(order(95603..95605,95633..95635,95642..95644,
FT                   95687..95689,95903..95905,95945..95947))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0076"
FT   misc_feature    complement(order(95759..95761,95771..95776,95792..95830))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0076"
FT   gene            complement(96313..97248)
FT                   /db_xref="GeneID:8423539"
FT                   /locus_tag="Aaci_0077"
FT   CDS_pept        complement(96313..97248)
FT                   /locus_tag="Aaci_0077"
FT                   /gene_family="HOG000220406" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce3058 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="GI:258510096"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:8423539"
FT                   /translation="MAKAAEAVIAQVEGERRSARGSMSLQITGLAMMAPALLFLLAFVF
FT                   VPMGYAVYLSLYQSTLYTPQPVFAGFANYAHLLAAPDFWQAASNTLWLAVGMMALSLPV
FT                   ALVLALLLNQRIRGRALFRAAVFGPYVIPLVSSGLIFSLLFATDGGPVNLALQRLGLSP
FT                   VNWLGQGRTALLSVLILTAWQFTGYYAIIFLAGLQSVPTSLMEACQVDGGGRWQVFRHV
FT                   TLRALGPSLFFAVVICLIQTFQTFDQVYVMTGGGPDGATTTFAYYIFEKGFQAFNIGES
FT                   SAASVILILVLACLSYLQMRLSRRWVVEES"
FT                   /protein_id="YP_003183530.1"
FT   misc_feature    complement(96364..96900)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0077"
FT   misc_feature    complement(order(96364..96369,96376..96381,96388..96393,
FT                   96397..96402,96418..96423,96451..96456,96496..96501,
FT                   96508..96519,96538..96540,96547..96552,96592..96594,
FT                   96643..96645,96652..96657,96667..96669,96673..96678,
FT                   96685..96687,96691..96693,96700..96705,96823..96825,
FT                   96829..96834,96841..96870,96874..96885))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0077"
FT   misc_feature    complement(order(96502..96519,96823..96867))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0077"
FT   misc_feature    complement(order(96421..96423,96451..96453,96460..96462,
FT                   96499..96501,96718..96720,96823..96825))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0077"
FT   misc_feature    complement(order(96571..96573,96583..96588,96604..96642))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Aaci_0077"
FT   gene            97441..98682
FT                   /db_xref="GeneID:8423540"
FT                   /locus_tag="Aaci_0078"
FT   CDS_pept        97441..98682
FT                   /locus_tag="Aaci_0078"
FT                   /gene_family="HOG000023469" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02073"
FT                   /codon_start="1"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   bhe:BH02500 aminopeptidase"
FT                   /db_xref="GI:258510097"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="GeneID:8423540"
FT                   /translation="MIEQMRKYAELVVRVGVNLQPGQPLVIGFGSRQVYPDQVPFARLL
FT                   AQAAYDAGASYVHIDWGDEWWLRETVKRADLAILRQCAQWQVEWVERLAEMGAAYVAMP
FT                   ASDPALFAGIPRDRVEQAERAVREAFRLFDNQRTSDRYRWTLASAPTQAWADAVHPELP
FT                   REDRLEALWRDILQASRATGEDPIADWEQHIANLKRRAAWLNDLKIHALHYRAPGTDLT
FT                   IELAEGHYFEAAGHPDVKGFRFVANIPTEEVFTAPKKTGVNGTVASTMPLNHGGSLIEG
FT                   IRLRFENGRIVEYSAEKGEEALKAIIEADEGSHYLGEVALVPVDSPIAQMNRIFYNTLF
FT                   DENASCHLAIGRAYPLIEGGHELAHEDWEAHGLNDSLMHVDFMIGSADLDIDAVLQDGR
FT                   TVPIFRKGRWASEA"
FT                   /protein_id="YP_003183531.1"
FT   misc_feature    97447..98667
FT                   /note="Thermophilic metalloprotease (M29); Region:
FT                   Peptidase_M29; pfam02073"
FT                   /db_xref="CDD:145308"
FT                   /locus_tag="Aaci_0078"
FT   gene            98712..100328
FT                   /db_xref="GeneID:8423541"
FT                   /locus_tag="Aaci_0079"
FT   CDS_pept        98712..100328
FT                   /locus_tag="Aaci_0079"
FT                   /gene_family="HOG000175618" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.3.2.2"
FT                   /codon_start="1"
FT                   /EC_number="2.3.2.2"
FT                   /transl_table="11"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   csa:Csal_1740 gamma-glutamyltransferase"
FT                   /db_xref="GI:258510098"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="GeneID:8423541"
FT                   /translation="MVKPHWDATQYEFESRRTVVFARRGMVATTQPLASEAGLEVLRRG
FT                   GNAIDAVVAAAAALAIVEPTSNGIGSDAFAIVWKDGKLHGLNASGHSPERLTRDELERR
FT                   GLRELPTHGWLPVTVPGAPAAWAALVERFGRLSLKDVLAPAVDLARDGFPVQPVTARNW
FT                   RRAMEAHRDRLTDPVHEPFFRLFAPGGEVPGPGDLFRNPDGARALEAIASSGGRAFYEG
FT                   EIADAIDAFARETGGLLSKADLAAYKPEWVEPLSVRYRDFEVWELPPNGQGIVALMALG
FT                   ALAGMDLASMDEADRAHAMLEAIKLAFEVALREVADPRFMRVTPASLLSKDHLDALRAK
FT                   IGDEAHLPAVERPYYGGTVYLCAADGEGNMVSYIQSNYMGFGSGIVVPGTGVSLQNRGH
FT                   NFSMDPSHPNALGPRKRPYHTIIPGFLTRGGEPVGPFGVMGGFMQPQGHVQVLVQMLDL
FT                   ARNPQSALDAPRWQWLQGKRVLAEAALGEDVIAKLRARGHEVDVTDDGTPFGRGQVIWR
FT                   LPNGALAGATEPRADGSIAAW"
FT                   /product="Gamma-glutamyltransferase"
FT                   /protein_id="YP_003183532.1"
FT   misc_feature    98745..100325
FT                   /note="Gamma-glutamyltransferase [Amino acid transport and
FT                   metabolism]; Region: Ggt; cl08040"
FT                   /db_xref="CDD:174918"
FT                   /locus_tag="Aaci_0079"
FT   misc_feature    98826..100310
FT                   /note="Gamma-glutamyltranspeptidase; Region:
FT                   G_glu_transpept; pfam01019"
FT                   /db_xref="CDD:144562"
FT                   /locus_tag="Aaci_0079"
FT   gene            complement(100377..101015)
FT                   /db_xref="GeneID:8423542"
FT                   /locus_tag="Aaci_0080"
FT   CDS_pept        complement(100377..101015)
FT                   /locus_tag="Aaci_0080"
FT                   /gene_family="HOG000242641" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00504"
FT                   /codon_start="1"
FT                   /EC_number="3.4.19.3"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_4364 pyrrolidone-carboxylate
FT                   peptidase; TIGRFAM: pyrrolidone-carboxylate peptidase;
FT                   PFAM: peptidase C15 pyroglutamyl peptidase I"
FT                   /db_xref="GI:258510099"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="GeneID:8423542"
FT                   /translation="MDAILVTGFEPFQGEALNPSWEVARSLAGETVGVHYRVIARRLPT
FT                   VYGRAGEELVSAIREVKPRAVVCLGEAGGRTHVTPERIAINIMDARIPDNAGQKPIDEP
FT                   IAPDGPAAYFSTLPIRAMVEAMCGAGIPAHISNTAGTFVCNDTFYRLMHFIAEESPGII
FT                   GGFIHVPYMTEQALHKQAPSLPLTTLVAGVRTALAVVASALGPAGVPKC"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /protein_id="YP_003183533.1"
FT   misc_feature    complement(100428..101006)
FT                   /note="Pyroglutamyl peptidase (PGP) type I, also known as
FT                   pyrrolidone carboxyl peptidase (pcp) type I:  Enzymes
FT                   responsible for cleaving pyroglutamate (pGlu) from the
FT                   N-terminal end of specialized proteins. The N-terminal pGlu
FT                   protects these proteins from...; Region: Peptidase_C15;
FT                   cd00501"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="Aaci_0080"
FT   misc_feature    complement(order(100584..100592,100881..100883,
FT                   100980..100982,100989..100991))
FT                   /note="putative substrate binding pocket; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="Aaci_0080"
FT   misc_feature    complement(order(100461..100463,100467..100472,
FT                   100488..100490,100494..100499,100614..100628,
FT                   100635..100637,100785..100793))
FT                   /note="AC domain interface; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="Aaci_0080"
FT   misc_feature    complement(order(100512..100514,100584..100586,
FT                   100773..100775))
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="Aaci_0080"
FT   misc_feature    complement(order(100593..100595,100602..100607,
FT                   100656..100658,100674..100685,100710..100715,
FT                   100743..100745,100749..100751,100755..100757,
FT                   100767..100772))
FT                   /note="AB domain interface; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="Aaci_0080"
FT   misc_feature    complement(100461..100463)
FT                   /note="interchain disulfide; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="Aaci_0080"
FT   gene            101198..101806
FT                   /db_xref="GeneID:8423543"
FT                   /locus_tag="Aaci_0081"
FT   CDS_pept        101198..101806
FT                   /locus_tag="Aaci_0081"
FT                   /gene_family="HOG000085119" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dal:Dalk_1395
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:258510100"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:8423543"
FT                   /translation="MRDRIEEAAKRAFSEFGYKGTTMDQIARLAGVSKGAIYLHFPSKE
FT                   ALFQHMLRGVIAQVRDAFESAQVEGDDYFRNLERGLRALMRFRADHAMLSKLVQEVRQF
FT                   GTAEARAGLGELEAAILDYLARHLKRGVELGVVRPCRANLVAFVLLRAYTAVLRDFPSA
FT                   EGPLSEEDLYQLFTGVFVDGLRLRPGEGEPRNTQSEQER"
FT                   /protein_id="YP_003183534.1"
FT   misc_feature    101201..>101491
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Aaci_0081"
FT   misc_feature    101216..101350
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Aaci_0081"
FT   gene            101812..104169
FT                   /db_xref="GeneID:8423544"
FT                   /locus_tag="Aaci_0082"
FT   CDS_pept        101812..104169
FT                   /locus_tag="Aaci_0082"
FT                   /gene_family="HOG000065090" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03062"
FT                   /codon_start="1"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: YhgE/Pip C-terminal domain protein;
FT                   YhgE/Pip N-terminal domain protein; KEGG: SRP ; K01421
FT                   putative membrane protein"
FT                   /db_xref="GI:258510101"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="GeneID:8423544"
FT                   /translation="MASVPEGTARGNVFQEFARLRRPKMMVQAAGIALIPVLYAGAFLW
FT                   AFWNPYGHLDRLPVAVVNEDAGASFRGERLNAGRDLVEKLRSDHSLGWHFVTPAQASAG
FT                   MADGAYAMEIVIPRDFSKRAVNRAEHTGAPAPEITSVTNDRYNYIAGVIGRNAAVKLAS
FT                   ETALELAKSYTASLVDALESSGTGLHKAAKAADALASGGRELEAKGELLVSGASQLAAG
FT                   ADRLAGGLEQASQGAGALAQGASQAVSGADRLNAGLVRLNQGAESLAQGASSWANQARA
FT                   FGEAGDKLGEAAQEVGQGASQLAAGAGKLTTSLGQLDTGASHLASGAEALAQNASQFAQ
FT                   AANQTAAGSQQVASGAKQLAEGLQQLAKANPALAETPAFQSLLATSAEVAQGAAQTASA
FT                   NEQLASGAAGLSQGASQLAAGAESLASGLKQAEAGAAPLQQGLQQLAQGASGVAQGGTR
FT                   LAAASGQLATGASQIAQGAKGLAAGTGAAQQASSSLRGGLVQLQGGAAKLAVGNRALAG
FT                   GAASLASGAGKLANGLGAYQAGVGKLASGSEALAANLANGASKLQALHGGAVIAAVAHP
FT                   VSLHQVELGDIQTYGNGFAPYFLSLGLYVGVLMMSVIFPFREPYGEPKSGVAWFFSKWL
FT                   LVVAIAWAQALIADAVVLGLVGVHTAHPLGFVLFSLFASTTFASILLALVALLDNPGRF
FT                   LGVVLLILQLTSTSGTYPVSLSPRFFQAVGPWLPMYATVSGFRYLIGGGDPSLMARDLA
FT                   ELAIYTASFIAIGVLLFAGFFRRLGRAEPKTV"
FT                   /protein_id="YP_003183535.1"
FT   misc_feature    101857..102345
FT                   /note="YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm;
FT                   TIGR03061"
FT                   /db_xref="CDD:132105"
FT                   /locus_tag="Aaci_0082"
FT   misc_feature    103525..104121
FT                   /note="YhgE/Pip C-terminal domain; Region: pip_yhgE_Cterm;
FT                   TIGR03062"
FT                   /db_xref="CDD:163121"
FT                   /locus_tag="Aaci_0082"
FT   gene            104303..106660
FT                   /db_xref="GeneID:8423545"
FT                   /locus_tag="Aaci_0083"
FT   CDS_pept        104303..106660
FT                   /locus_tag="Aaci_0083"
FT                   /gene_family="HOG000040246" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mlg_1110"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aeh:Mlg_1110 hypothetical protein"
FT                   /db_xref="GI:258510102"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="GeneID:8423545"
FT                   /translation="MEGQPSARHPDWESEQAYVDRVVAAMRAKLAELEGVLRGVRGEIV
FT                   EFRRHFWDDVTINLSTLDDLVETHFAIRQQAEVLGERERRYQQAAKTKRTLERQISSPF
FT                   FARIDFRYEGEREAEPIYIGIASFRDERDQTFLVHDWRAPISSVYYDALPGPASFKAPA
FT                   GIVRGELTLKRQFVIRGGAILAMFDAGLTIGDELLMYALSRRSDAQMHNIVATIQRQQN
FT                   VVIRDDESPALLVTGAAGSGKTSAALQRAAYLLYKHRGDLDARQMLFFSPNPLFMSYIS
FT                   NVLPELGEDNIEQATFYDYLCARLQDEFVVEDPFDQMERLLEAGEDSRMARAVRYKASK
FT                   AFADEIDRYVAGLAPQMRFHPILVEGRVIATATDVKAAFDRTDPGLRLPLRVDLVKEEL
FT                   LNRLRQFERDEALSDWVQKAVDGLPDEAYRRAERTAAKRKRERPDLDEQEEARRLLGRE
FT                   VLRRMLRPVRRFVETLRFVDTAGMYRAWFEQAASSPPEGFQSEDWAQICRQTVREMDEG
FT                   TLWYEDATPYLYMKEQILGRAVSAPIRHVLVDEVQDYSVLQLRLIRSLFPYSRITMLGD
FT                   PEQLVSPHRPGILEEDEMARLFPGLVRVAFGQSYRSTRQIVLFTRGMVPKGAEIQPFDR
FT                   DGALPRLAEVSGEAQQAGVIARWLGEFADAGYQTTAVLTKTQAEAERLAKALERLGVKL
FT                   RRLDKRAVSLEPGVVVAPVYLAKGVEFDGVIVANVSREQYQTALDRQLLYTACTRAMHE
FT                   LRMVSVGEASPWILSQPADTYERVDAAEVNAT"
FT                   /protein_id="YP_003183536.1"
FT   misc_feature    104336..106585
FT                   /note="Superfamily I DNA and RNA helicases [General
FT                   function prediction only]; Region: COG3973"
FT                   /db_xref="CDD:33754"
FT                   /locus_tag="Aaci_0083"
FT   misc_feature    <105911..>106153
FT                   /note="UvrD/REP helicase; Region: UvrD-helicase; cl14126"
FT                   /db_xref="CDD:175496"
FT                   /locus_tag="Aaci_0083"
FT   gene            106657..107280
FT                   /db_xref="GeneID:8423546"
FT                   /locus_tag="Aaci_0084"
FT   CDS_pept        106657..107280
FT                   /locus_tag="Aaci_0084"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /codon_start="1"
FT                   /product="Phosphoglycerate mutase"
FT                   /transl_table="11"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pca:Pcar_2741
FT                   phosphoglycerate mutase/fructose-2,6-bisphosphatase"
FT                   /db_xref="GI:258510103"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:8423546"
FT                   /translation="MKIYLFRHGQTVYNADGERFCGTSDVGLTALGWQQARRAARLIRG
FT                   VRPAAIVHSGLRRSLETAMAIRESLPGAADCPLVAHEGFREVGFGAWEGLTRAEVNRLY
FT                   PELYAEWLARPEEARIPGGDDLYERQQEAVDAFLDVVARYRDGDLVIVAHNTLNRLLIL
FT                   GLMGLDARHYRRIVQENACLNILEYHEEEGVRLHALNRVPEQDE"
FT                   /protein_id="YP_003183537.1"
FT   misc_feature    106660..107247
FT                   /note="Histidine phosphatase domain found in
FT                   phosphoglycerate mutases and related proteins, mostly
FT                   phosphatases; contains a His residue which is
FT                   phosphorylated during the reaction; Region: HP_PGM_like;
FT                   cd07067"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="Aaci_0084"
FT   misc_feature    order(106675..106680,106828..106830,107116..107121)
FT                   /note="catalytic core; other site"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="Aaci_0084"
FT   gene            107356..108630
FT                   /db_xref="GeneID:8423547"
FT                   /locus_tag="Aaci_0085"
FT   CDS_pept        107356..108630
FT                   /locus_tag="Aaci_0085"
FT                   /gene_family="HOG000100403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /codon_start="1"
FT                   /EC_number="5.3.1.9"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   dds:Ddes_0851 glucose-6-phosphate isomerase"
FT                   /db_xref="GI:258510104"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="GeneID:8423547"
FT                   /translation="MIELSLEKARKWFTEEHEARLAPLAQFALGELNNRDRDAFGKGWI
FT                   DWPAADHSALYRDVDAIAADFRAKSNATVVIGIGGSYLGAQSALSMAKPAFTGEGHHEV
FT                   IFAGQQLSPTYHAHLLQYLDKREVTLVVVSKSGTTLEPSAVFHTFREYLEKRYGVEEAN
FT                   RRICAITDAEKGSLRQFADERKYATLPIPDDIGGRYSVLTAVGLLPMALAGIDYKRVMQ
FT                   GAARMREELSKLKVADHPAVKYALARHVLYQQGFVAEALVTYEPRVADFAGWWQQLFGE
FT                   SQGKDGTGLFPTMLRYTTDLHSMGQYVQDARKILVETVLDVHFSDEPELVVPRGLDEKN
FT                   AYLDGVSFSRLQEVAVESVMVAHSEAGVPNILIRAKGDPESLYGELVYFFEVACAVGGY
FT                   LMGTNPFDQPGVEAYKNEMRSRLKA"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /protein_id="YP_003183538.1"
FT   misc_feature    107356..108609
FT                   /note="glucose-6-phosphate isomerase; Provisional; Region:
FT                   pgi; PRK14097"
FT                   /db_xref="CDD:172587"
FT                   /locus_tag="Aaci_0085"
FT   misc_feature    107515..107994
FT                   /note="Phosphoglucose isomerase (PGI) contains two SIS
FT                   (Sugar ISomerase) domains. This classification is based on
FT                   the alignment of the first SIS domain. PGI is a
FT                   multifunctional enzyme which as an intracellular dimer
FT                   catalyzes the reversible isomerization of...; Region:
FT                   SIS_PGI_1; cd05015"
FT                   /db_xref="CDD:88410"
FT                   /locus_tag="Aaci_0085"
FT   misc_feature    order(107587..107589,107593..107598,107755..107763,
FT                   107770..107772,107944..107946)
FT                   /note="active site"
FT                   /db_xref="CDD:88410"
FT                   /locus_tag="Aaci_0085"
FT   misc_feature    order(107680..107691,107776..107778,107788..107790,
FT                   107797..107799)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88410"
FT                   /locus_tag="Aaci_0085"
FT   misc_feature    108127..108612
FT                   /note="Phosphoglucose isomerase (PGI) contains two SIS
FT                   (Sugar ISomerase) domains. This classification is based on
FT                   the alignment of the second SIS domain. PGI is a
FT                   multifunctional enzyme which as an intracellular dimer
FT                   catalyzes the reversible isomerization of...; Region:
FT                   SIS_PGI_2; cd05016"
FT                   /db_xref="CDD:88411"
FT                   /locus_tag="Aaci_0085"
FT   misc_feature    order(108148..108150,108184..108186,108196..108198,
FT                   108205..108210,108238..108240,108244..108252,
FT                   108259..108264,108271..108276,108283..108285,
FT                   108397..108399,108403..108405,108427..108429,
FT                   108436..108438)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88411"
FT                   /locus_tag="Aaci_0085"
FT   misc_feature    order(108184..108186,108196..108198)
FT                   /note="active site"
FT                   /db_xref="CDD:88411"
FT                   /locus_tag="Aaci_0085"
FT   gene            108654..109595
FT                   /db_xref="GeneID:8423548"
FT                   /locus_tag="Aaci_0086"
FT   CDS_pept        108654..109595
FT                   /locus_tag="Aaci_0086"
FT                   /gene_family="HOG000150087" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00744"
FT                   /codon_start="1"
FT                   /product="glucokinase, ROK family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glucokinase, ROK family; PFAM: ROK family
FT                   protein; KEGG: mlo:mlr7234 glucose kinase"
FT                   /db_xref="GI:258510105"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="GeneID:8423548"
FT                   /translation="MEQKLALGIDIGGTNVKLAIVRSDGRVLVDRSIPTAPERGPEAFS
FT                   RTVGAEARAMANEASVAWDSVVGAGVGMAGFLDVERGWVEEAVNLHWRDVPLADLLQSA
FT                   LDKPVRVDNDANVAALGEVWLGAGQNAHTALCVTLGTGVGGGIVIGGRIHRGASTMAGE
FT                   IGHIMVKNDGELCNCGHRGCLETLASATALVRHAVAAGVKSPGGGELTAKEVFALAAEG
FT                   DPAARAVVDDMIHWLAVGLAVVANILNPDVIVVAGGLVNAGDQLMEPLRAAFQREALAR
FT                   VARACRLVPAKLGDQAGVLGAARLVLQDIESL"
FT                   /protein_id="YP_003183539.1"
FT   misc_feature    108672..109571
FT                   /note="ROK family protein (putative glucokinase); Region:
FT                   ROK_glcA_fam; TIGR00744"
FT                   /db_xref="CDD:162017"
FT                   /locus_tag="Aaci_0086"
FT   misc_feature    108675..109232
FT                   /note="ROK family; Region: ROK; cl09121"
FT                   /db_xref="CDD:175010"
FT                   /locus_tag="Aaci_0086"
FT   misc_feature    <109287..109466
FT                   /note="Acetokinase family; Region: Acetate_kinase; cl01029"
FT                   /db_xref="CDD:174499"
FT                   /locus_tag="Aaci_0086"
FT   gene            complement(109643..109882)
FT                   /db_xref="GeneID:8423549"
FT                   /locus_tag="Aaci_0087"
FT   CDS_pept        complement(109643..109882)
FT                   /locus_tag="Aaci_0087"
FT                   /gene_family="HOG000245309" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03698"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0180"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0180"
FT                   /db_xref="GI:258510106"
FT                   /db_xref="InterPro:IPR005370"
FT                   /db_xref="GeneID:8423549"
FT                   /translation="MKAVAVEPGLTPVKEYLQSQGCQVVDMSSHMEPSVGAVVITGLDK
FT                   NLMGMQSAIQQVPVISADGLSPEAVYDRVKDYLR"
FT                   /protein_id="YP_003183540.1"
FT   misc_feature    complement(109646..109882)
FT                   /note="Uncharacterized protein family (UPF0180); Region:
FT                   UPF0180; cl04214"
FT                   /db_xref="CDD:174810"
FT                   /locus_tag="Aaci_0087"
FT   gene            109981..110310
FT                   /db_xref="GeneID:8423550"
FT                   /locus_tag="Aaci_0088"
FT   CDS_pept        109981..110310
FT                   /locus_tag="Aaci_0088"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510107"
FT                   /db_xref="GeneID:8423550"
FT                   /translation="MGHVHMIFGVILIILAILATAWEIAAQRGLPRALRGVVIGLFDLQ
FT                   VLLGIITWIVRRPNWSFVFHPIIMIVAVIILHVMTSPSATRSRRLTGWIVATVLFIIGA
FT                   AIYHA"
FT                   /protein_id="YP_003183541.1"
FT   gene            110452..110766
FT                   /db_xref="GeneID:8423551"
FT                   /locus_tag="Aaci_0089"
FT   CDS_pept        110452..110766
FT                   /locus_tag="Aaci_0089"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510108"
FT                   /db_xref="GeneID:8423551"
FT                   /translation="MADRLQLQIRYPEQGLTERERQLVVCLVQRICVHHLQRRRDRSVH
FT                   IRPANVDSIHLLVNEVIEVEPALADDERGEILRALVEDVNRTLALCGIRGEDIVRVHLA
FT                   "
FT                   /protein_id="YP_003183542.1"
FT   gene            110820..111047
FT                   /db_xref="GeneID:8423552"
FT                   /locus_tag="Aaci_0090"
FT   CDS_pept        110820..111047
FT                   /locus_tag="Aaci_0090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510109"
FT                   /db_xref="GeneID:8423552"
FT                   /translation="MAVKLHISTFQMPDGMYIATCAEIPMCRALRQNKGHAVQDVKQQI
FT                   RRFLAERQAENRPFEPEPLLEIEIEAPNGA"
FT                   /protein_id="YP_003183543.1"
FT   gene            111113..111188
FT                   /note="tRNA-Met1"
FT                   /db_xref="GeneID:8423553"
FT                   /locus_tag="Aaci_R0005"
FT   tRNA            111113..111188
FT                   /db_xref="GeneID:8423553"
FT                   /locus_tag="Aaci_R0005"
FT                   /product="tRNA-Met"
FT   gene            111192..111268
FT                   /note="tRNA-Asp1"
FT                   /db_xref="GeneID:8423554"
FT                   /locus_tag="Aaci_R0006"
FT   tRNA            111192..111268
FT                   /db_xref="GeneID:8423554"
FT                   /locus_tag="Aaci_R0006"
FT                   /product="tRNA-Asp"
FT   gene            complement(111332..113470)
FT                   /db_xref="GeneID:8423555"
FT                   /locus_tag="Aaci_0091"
FT   CDS_pept        complement(111332..113470)
FT                   /locus_tag="Aaci_0091"
FT                   /gene_family="HOG000072128" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /codon_start="1"
FT                   /product="MMPL domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MMPL domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="GI:258510110"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="GeneID:8423555"
FT                   /translation="MHRFEPKVRTWSRTWRAAAILGWLLAAALLAAVFPAASKEEINRS
FT                   TLLPASAPSQMATARVRDAFPASSGTPAILVFYDPTGISSADWAAIRRTVRELRTHPVT
FT                   AQTQVPPLDALPSGAAARFASDDGKVVSFPVLLRADASQDQLNQAVDEIDQDLRRAVGA
FT                   GALNLALDRPGLHAYVTGPAGIAVDATHLFQHADLALLIATTLLVLALMIVLYRSPILA
FT                   LVPLVSVGIAYAVVSSLLGAWARYGGLTFDAQTLSILTVLLFGAGTDYCLFLIARYRQE
FT                   LRRHERPIDALRAGYKSAAGAILMSGLTVSASLLSLLAARSPSFHEFAIPFSVAVFVMA
FT                   LVAITFVPALIGSLGRAAFWPRIPRYEPDAPDAGRPGRVSRWLGRTAVRRRKPVAVLGS
FT                   LALAACCLALPHVRTSYDLLSSFPADMPSREGYAVLSAHESPGALAPIDVLVEGGSPEG
FT                   AVRAVQSLAAVEQVHLVAVRDHAHVALMQVELRTNPYSETAMAALSSIERAAAKGASAG
FT                   GQAAHVFLAGETAAQEDTRAITARDTRVVIPIVLVAIGLLLLVYLRSVVAPLYLLATIV
FT                   LSYGAAMGLGWLVIREVLHQPAMQGAIPLYAFVFLVALGEDYNIFVMSRIWEVWRRGQA
FT                   DAAVERGVADTASVITSAGLILAGTFAMLASLPIQVLLQFGVVTAIGVLLDTFVVRPWM
FT                   VPAITALLGDAARWPRRT"
FT                   /protein_id="YP_003183544.1"
FT   misc_feature    complement(<111344..113338)
FT                   /note="Predicted drug exporters of the RND superfamily
FT                   [General function prediction only]; Region: COG2409"
FT                   /db_xref="CDD:32544"
FT                   /locus_tag="Aaci_0091"
FT   gene            113595..114218
FT                   /db_xref="GeneID:8423556"
FT                   /locus_tag="Aaci_0092"
FT   CDS_pept        113595..114218
FT                   /locus_tag="Aaci_0092"
FT                   /gene_family="HOG000090092" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dac:Daci_0033
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:258510111"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:8423556"
FT                   /translation="MRNARSRRPGRPPQVEMEEPTAEKILRAAAECFMDQGFAAVSMDD
FT                   VAERAGVTKAVVYYYYGSKTELFQRAMMEVMRASRERTQAILRENGPLRERLQKLTRTR
FT                   LAIPATLDMNHILRGSQRALRPDQVDEMHRAEEQLVEVIAQELHAEMEQGRLRPVDAMF
FT                   VARSYLALLGMGQAEIRRRGGGQAAIDEIAEEIVDLLWRGIEPR"
FT                   /protein_id="YP_003183545.1"
FT   misc_feature    113619..114215
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Aaci_0092"
FT   misc_feature    113667..113807
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Aaci_0092"
FT   gene            114330..114440
FT                   /db_xref="GeneID:8423557"
FT                   /locus_tag="Aaci_0093"
FT   CDS_pept        114330..114440
FT                   /locus_tag="Aaci_0093"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510112"
FT                   /db_xref="GeneID:8423557"
FT                   /translation="MYGVFGGYTRWAVVFLIIFVLFFLFVPAAPVATASC"
FT                   /protein_id="YP_003183546.1"
FT   gene            complement(114562..115107)
FT                   /db_xref="GeneID:8423558"
FT                   /locus_tag="Aaci_0094"
FT   CDS_pept        complement(114562..115107)
FT                   /locus_tag="Aaci_0094"
FT                   /gene_family="HOG000201072" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03079"
FT                   /codon_start="1"
FT                   /product="Acireductone dioxygenase ARD"
FT                   /transl_table="11"
FT                   /note="PFAM: Acireductone dioxygenase ARD; Cupin 2
FT                   conserved barrel domain protein; KEGG: dda:Dd703_0920
FT                   acireductone dioxygenase ARD"
FT                   /db_xref="GI:258510113"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:8423558"
FT                   /translation="MVAYVRIRNTGEEIRGEDQVREFLNRNEVYYDHWDVDRKLPEALK
FT                   GKFDLSDAEKDEILQALQEEIQDLSRKRGYVKWDVISLSESTPNLDELLKKFEQVHTHT
FT                   EDEVRAIVSGSGIFIIKGKDGGYFDVVLSAGDVISVPEGNPHFFTLTDERKVVAVRLFI
FT                   DPAGWVAHPYEDPAFQQA"
FT                   /protein_id="YP_003183547.1"
FT   misc_feature    complement(114595..115104)
FT                   /note="Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain [Function unknown];
FT                   Region: COG1791"
FT                   /db_xref="CDD:31976"
FT                   /locus_tag="Aaci_0094"
FT   misc_feature    complement(114631..114807)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Aaci_0094"
FT   gene            complement(115223..116308)
FT                   /db_xref="GeneID:8423559"
FT                   /locus_tag="Aaci_0095"
FT   CDS_pept        complement(115223..116308)
FT                   /locus_tag="Aaci_0095"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce4410 hypothetical protein"
FT                   /db_xref="GI:258510114"
FT                   /db_xref="GeneID:8423559"
FT                   /translation="MKDRTEGARRARDAHERASWKRNWSTWLGLCSTMAIAMTVAGCGA
FT                   TQTAKTDLAGGMNGAGAVRNVANTAASSADAAPASSSASHAGTRTAPESANAGRAPNPG
FT                   EMVRSVMQAALRGSLPGVPFADGENIDQVIKAWGSPSSQAYAGSGVYFTYRAKDVAFGL
FT                   NKGEQIFDVRSYAQALRTLTYHEIAGVLGAPGSVRYTQDSYIYLYPAGPDYQLLWVFPR
FT                   LPSGHSGPTVDHVSVFWPQGTVDLMAATQPAPDVVIDRPPSGRGHTVSFHLANAPKGYR
FT                   LEEIEWIPKRGDAVVDTWAQTLARAEAHATAPGFLAYPNQASMVFVYAPWMQGEMGQIR
FT                   VIYQATSGAAMLGNSAWLSLS"
FT                   /protein_id="YP_003183548.1"
FT   gene            116583..117818
FT                   /db_xref="GeneID:8423560"
FT                   /locus_tag="Aaci_0096"