(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE1

ALIAD_1.PE1          Location/Qualifiers
FT   CDS_pept        112..1476
FT                   /locus_tag="Aaci_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: geo:Geob_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="GI:258510021"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="GeneID:8426153"
FT                   /translation="MMSTKVDPTYDALWNQVLQMVQDKVSGPTYSTWFEDTHIVRIDES
FT                   EQTVYISAPSTFVRNWLSEHYTSLVETLMMTLMDREYRVRFITEDDVQAPAVIVRRAPE
FT                   PVTAEEDTETNLNPRYTFDSFVIGAGNRFAHAACLAVAERPANAYNPLFIYGGVGLGKT
FT                   HLMHAIGHYVRQHYPNFKVSYISSERFTNEFIAAIRDKNPDSFRARYRTVDVLLIDDIQ
FT                   FIANKEQTQEEFFHTFNSLHEVGKQIVISSDRPPREIPTLEDRLRSRFEWGLITDIQPP
FT                   DLETRIAILQRKAKADGLDVPVDVLAFIANQIDSNIRELEGALTRVIAYSSLVKEDLSV
FT                   ALAEEALKDLIHPNRPRAVTVNHVQKVVADHYGLKVDDLKGKKRTRNIAFPRQIAMYLT
FT                   RELTDLSLPRIGEAFGGRDHTTVMHACERVHEEMMRDDELRATIERLSQAIRTLT"
FT                   /protein_id="YP_003183455.1"
     GTGATGAGTA CCAAAGTCGA TCCGACCTAC GACGCGCTGT GGAACCAGGT CCTCCAGATG        60
     GTTCAGGACA AGGTCTCCGG GCCCACCTAC AGCACCTGGT TCGAGGACAC CCACATCGTC       120
     CGAATCGATG AGTCGGAGCA AACGGTCTAC ATCTCCGCGC CCTCCACATT CGTACGCAAC       180
     TGGCTGTCCG AACATTACAC TTCCCTCGTC GAAACGCTGA TGATGACCCT CATGGACCGC       240
     GAGTATCGGG TGCGATTTAT CACAGAGGAC GACGTGCAGG CCCCCGCCGT GATCGTTCGG       300
     CGCGCGCCCG AACCGGTGAC AGCCGAAGAA GACACGGAGA CCAACCTCAA CCCCCGTTAC       360
     ACGTTTGACT CGTTCGTCAT CGGCGCGGGC AACCGCTTTG CACACGCCGC GTGCCTCGCC       420
     GTTGCAGAGC GTCCTGCGAA CGCGTACAAC CCGCTCTTCA TCTATGGCGG CGTGGGGCTT       480
     GGGAAGACGC ACCTCATGCA CGCCATCGGG CACTACGTGC GCCAACATTA TCCGAATTTC       540
     AAAGTCAGTT ACATATCCTC CGAGCGATTT ACGAACGAGT TCATCGCGGC CATCCGCGAC       600
     AAGAACCCCG ACTCGTTCCG AGCTCGCTAC CGCACCGTCG ATGTGCTTTT GATTGACGAC       660
     ATTCAGTTCA TCGCGAACAA GGAACAGACG CAGGAGGAGT TCTTCCATAC CTTCAACAGT       720
     CTTCACGAGG TCGGAAAGCA AATCGTCATC TCGAGCGATC GCCCGCCTCG GGAGATTCCG       780
     ACGCTTGAAG ACCGGCTTCG TTCGCGTTTC GAATGGGGGC TCATCACCGA CATCCAACCG       840
     CCCGATCTCG AGACGCGCAT CGCCATCCTG CAGCGCAAGG CGAAAGCGGA CGGCTTGGAC       900
     GTTCCCGTCG ACGTGCTCGC CTTCATCGCC AACCAAATCG ACTCGAACAT CCGGGAACTC       960
     GAGGGCGCGC TCACGCGAGT CATTGCGTAC TCTTCGCTCG TGAAGGAAGA TCTCAGCGTG      1020
     GCCCTCGCCG AGGAAGCCTT GAAGGACCTC ATCCACCCGA ACCGCCCCCG CGCGGTGACG      1080
     GTGAATCACG TCCAGAAAGT GGTGGCCGAT CACTACGGTC TCAAGGTCGA CGACCTGAAG      1140
     GGCAAGAAGC GGACGCGGAA TATCGCGTTC CCTCGCCAGA TTGCGATGTA TCTGACGCGC      1200
     GAGCTGACGG ATCTCTCGCT GCCCCGCATT GGAGAGGCCT TCGGCGGGCG AGATCACACG      1260
     ACGGTCATGC ACGCCTGCGA ACGGGTGCAC GAGGAAATGA TGAGGGACGA CGAGCTGCGC      1320
     GCCACCATCG AGCGGCTCAG CCAAGCGATA AGGACACTCA CCTAA                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page