(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE11

ALIAD_1.PE11         Location/Qualifiers
FT   CDS_pept        16155..17639
FT                   /locus_tag="Aaci_0011"
FT                   /gene_family="HOG000165754" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.205"
FT                   /transl_table="11"
FT                   /note="KEGG: gsu:GSU2195 inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="GI:258510031"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="GeneID:8423472"
FT                   /translation="MTSAWEHKFVGEALTFDDVLLLPAHSTVLPRDVDVSTRLTTDIRL
FT                   NIPIVSAAMDTVTTSPMAIAMAREGGIGIIHKNMSIEAQAEEVDRVKRSESGVITNPIY
FT                   LTPDKPLRDAEALMSKYRISGVPIVECGSQKLIGIITNRDLRFERDDSRPIGEVMTREN
FT                   LITAPVGTTLAEAKEILQRHKIEKLPLVDAEGNLRGLITIKDIENARRFPNAAKDSQGR
FT                   LLVGAAVTVSPDVMDRVDALVAAHCDVIVVDTAHGHSEFVLKVVREIRSRYPDIQLIGG
FT                   NVATAAGCEALMEAGVNAVKVGIGPGSICTTRVVAGVGVPQITAIYDCSNAARKRGIPI
FT                   IADGGIKYSGDIVKAISAGASSVMIGSLLAGTAESPGEIEIYQGRQFKVYRGMGSIGAM
FT                   RAGSGDRYFQGDNSEGDTKKLVPEGIEGRVAYRGPVSETLYQLVGGLRSGMGYTGCATI
FT                   QELQEKSQMVRITSAGLRESHPHDVQITKEAPNYSI"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /protein_id="YP_003183465.1"
     GTGACGAGCG CCTGGGAACA CAAATTTGTG GGGGAAGCCC TGACCTTCGA CGATGTGCTG        60
     TTATTGCCAG CTCACTCGAC CGTTCTTCCG CGGGACGTGG ACGTCTCCAC CCGGTTGACC       120
     ACGGATATTC GCCTCAACAT CCCCATCGTG TCCGCCGCGA TGGACACCGT CACCACTTCG       180
     CCGATGGCCA TCGCGATGGC GCGCGAGGGC GGGATCGGCA TCATTCACAA GAACATGTCC       240
     ATCGAGGCGC AGGCCGAAGA GGTCGATCGC GTCAAACGCT CCGAGAGCGG CGTCATCACC       300
     AACCCCATCT ATCTCACGCC GGACAAGCCC CTGCGCGACG CGGAAGCGCT CATGAGCAAG       360
     TATCGAATCT CGGGCGTTCC GATTGTGGAA TGCGGATCGC AGAAGCTCAT TGGGATCATC       420
     ACGAACCGGG ATCTGCGCTT CGAACGGGAC GATTCTCGAC CCATCGGGGA AGTCATGACC       480
     CGCGAGAACC TCATCACCGC GCCGGTGGGA ACGACGCTGG CGGAGGCGAA GGAGATCCTT       540
     CAGCGGCACA AGATTGAAAA GCTGCCGCTC GTCGATGCCG AGGGCAACCT GCGGGGCCTC       600
     ATCACCATCA AGGACATCGA GAACGCTCGC CGATTCCCGA ATGCGGCGAA GGATTCGCAG       660
     GGCCGTCTTT TGGTCGGTGC GGCGGTGACG GTTTCGCCCG ACGTGATGGA TCGCGTCGAT       720
     GCGCTCGTGG CGGCGCACTG TGACGTGATC GTGGTGGATA CGGCGCACGG GCATTCGGAG       780
     TTCGTGCTCA AGGTCGTCCG CGAAATTCGT TCGCGCTATC CGGACATTCA GCTGATTGGC       840
     GGCAATGTGG CGACGGCGGC GGGCTGCGAG GCGCTGATGG AAGCGGGCGT CAACGCCGTG       900
     AAGGTCGGCA TCGGTCCGGG GTCCATCTGC ACCACCCGTG TCGTGGCGGG CGTGGGCGTG       960
     CCGCAGATCA CGGCCATTTA CGACTGCTCC AACGCAGCGC GCAAGCGCGG CATTCCCATC      1020
     ATCGCGGACG GCGGCATCAA GTACTCCGGC GACATCGTCA AGGCGATCTC GGCCGGCGCA      1080
     AGCTCAGTGA TGATCGGAAG CCTGCTCGCA GGGACGGCGG AAAGCCCGGG CGAGATCGAG      1140
     ATCTACCAGG GCAGGCAGTT CAAGGTGTAC CGCGGCATGG GCTCCATCGG TGCGATGCGG      1200
     GCCGGATCGG GCGATCGCTA CTTCCAAGGC GACAATTCGG AAGGGGACAC GAAGAAGCTC      1260
     GTGCCGGAGG GCATCGAGGG GCGCGTGGCG TACCGCGGGC CGGTGAGCGA GACGCTGTAT      1320
     CAGCTCGTCG GCGGCCTGCG AAGCGGCATG GGTTACACGG GGTGCGCCAC CATCCAGGAG      1380
     TTGCAGGAGA AGAGCCAGAT GGTGCGGATC ACATCGGCGG GTCTGCGCGA GAGCCATCCG      1440
     CACGACGTGC AGATCACCAA AGAAGCGCCG AACTATTCGA TTTGA                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page