(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE13

ALIAD_1.PE13         Location/Qualifiers
FT   CDS_pept        18694..19275
FT                   /locus_tag="Aaci_0013"
FT                   /gene_family="HOG000039949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /codon_start="1"
FT                   /product="SNO glutamine amidotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   dds:Ddes_1897 SNO glutamine amidotransferase"
FT                   /db_xref="GI:258510033"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="GeneID:8423474"
FT                   /translation="MKIAVIAVQGAFREHIAALKSLGVEAYEAKWARDLEGADGVIIPG
FT                   GESTAIGKLMREYDMLEPVRALARAGKPIYGTCAGMIVLAKRIEGEDTVHLGLMDVTVR
FT                   RNSFGRQRESFEAEIDIPAIGAPPFPAVFIRAPHIVSVGEGVEVLATYEDRIVAVRQGN
FT                   LLATSFHPELTDDYRLHQYFLNMAQAPVAH"
FT                   /protein_id="YP_003183467.1"
     ATGAAGATTG CCGTGATTGC GGTGCAGGGC GCGTTTCGGG AGCACATCGC GGCCTTGAAG        60
     TCGCTCGGGG TGGAGGCCTA CGAGGCCAAG TGGGCGCGCG ATCTCGAGGG CGCGGACGGC       120
     GTGATCATCC CGGGCGGCGA ATCGACGGCC ATCGGCAAGC TGATGCGGGA GTATGACATG       180
     CTGGAGCCCG TCCGCGCATT GGCTCGCGCG GGCAAGCCCA TTTACGGCAC CTGCGCCGGC       240
     ATGATTGTGC TCGCCAAGCG CATCGAGGGA GAGGACACCG TCCACCTCGG CCTGATGGAC       300
     GTGACCGTGC GCCGCAACTC GTTCGGGCGG CAGCGCGAGT CGTTTGAGGC CGAGATCGAC       360
     ATCCCGGCCA TTGGCGCGCC CCCGTTCCCA GCCGTGTTCA TTCGCGCGCC GCACATCGTG       420
     TCCGTGGGCG AAGGCGTGGA GGTCCTTGCG ACGTACGAGG ATCGCATTGT GGCTGTGCGG       480
     CAGGGCAATC TCCTCGCCAC GTCGTTCCAT CCGGAGCTCA CGGACGACTA CCGCCTGCAC       540
     CAATACTTCT TGAACATGGC GCAGGCGCCG GTGGCACATT GA                          582
//

If you have problems or comments...

PBIL Back to PBIL home page