(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE14

ALIAD_1.PE14         Location/Qualifiers
FT   CDS_pept        19295..20575
FT                   /locus_tag="Aaci_0014"
FT                   /gene_family="HOG000035938" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.11"
FT                   /transl_table="11"
FT                   /note="KEGG: gbm:Gbem_0108 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="GI:258510034"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR018156"
FT                   /db_xref="GeneID:8423475"
FT                   /translation="MLDIRAIRQQPDVFKAKLKRKKVDPAEIDRLLEADARWRDHLAEV
FT                   ERLKALRNQTSEAIARKKRQGEDASEDIARMREVSDRIQALDEEVRELERQVRDLLLAL
FT                   PNVPHDSVPDGESEDDNPVIKTWGDLPKFSFEPKPHWEIAEALDIVDSERAVKITGSRF
FT                   VLYKGLGARLERALANFMLDFHVERHGYTEMFPAFIANEESLIGTGNLPKFGDEMFKIE
FT                   GLPYYLIPTAEVPLTNYYRDEILSADQLPVKFAGYSACFRSEAGSAGKDTRGLIRLHQF
FT                   QKVELVNLCLPEQSYEVLEQLTREAEAVLEALQLPYRRIEICTGDLGAKDAKKYDIEVW
FT                   LPAQNRYREISSCTNFEDYQARRANLRFRREERGKPEFVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGSVLIPRALVPYMGGIERIAKG"
FT                   /product="seryl-tRNA synthetase"
FT                   /protein_id="YP_003183468.1"
     ATGTTAGATA TCCGAGCCAT TCGGCAACAA CCCGACGTGT TCAAAGCGAA GCTCAAGCGG        60
     AAGAAGGTCG ATCCGGCCGA GATCGACCGG CTGCTCGAGG CGGACGCCAG ATGGCGGGAT       120
     CATCTGGCGG AGGTGGAGCG CCTCAAAGCG CTGCGCAATC AGACGTCCGA GGCCATCGCG       180
     CGCAAGAAGC GGCAGGGGGA GGACGCGAGC GAGGACATCG CGCGGATGCG CGAGGTGTCG       240
     GACCGGATTC AGGCGCTGGA CGAAGAGGTT CGCGAGTTGG AGCGGCAAGT GCGGGACCTG       300
     CTGCTCGCGC TGCCGAACGT GCCGCACGAC TCGGTGCCGG ACGGCGAGTC GGAGGACGAC       360
     AACCCGGTCA TCAAGACGTG GGGAGATCTT CCGAAGTTCT CCTTCGAGCC GAAACCGCAC       420
     TGGGAGATTG CGGAGGCGCT CGACATCGTC GACAGCGAGC GCGCCGTGAA GATCACCGGC       480
     AGCCGCTTCG TGCTGTACAA GGGCCTCGGC GCACGGCTGG AGCGGGCGCT CGCGAACTTC       540
     ATGCTCGATT TCCACGTGGA GCGGCACGGC TACACGGAGA TGTTTCCGGC GTTCATCGCG       600
     AACGAGGAGA GCCTCATCGG CACGGGCAAC CTGCCGAAGT TCGGCGACGA GATGTTCAAA       660
     ATCGAGGGGT TGCCCTACTA CCTCATCCCG ACGGCCGAGG TGCCGCTCAC GAACTACTAC       720
     CGGGACGAGA TCCTGTCGGC CGACCAACTG CCGGTGAAAT TCGCGGGCTA TTCGGCCTGC       780
     TTCCGCTCGG AGGCCGGATC GGCGGGGAAG GATACGCGCG GGCTGATTCG GCTGCACCAG       840
     TTCCAGAAGG TGGAGCTCGT CAATCTGTGC CTTCCGGAGC AGTCGTACGA GGTCCTCGAG       900
     CAGCTGACGC GCGAAGCGGA GGCTGTGCTC GAGGCGCTCC AGCTTCCGTA CCGCCGCATT       960
     GAGATCTGCA CGGGCGATCT CGGCGCGAAG GACGCGAAGA AGTACGACAT CGAGGTCTGG      1020
     CTGCCGGCGC AGAACCGGTA CCGCGAGATC TCGTCGTGCA CGAACTTCGA AGACTACCAG      1080
     GCGCGGCGCG CCAACCTGCG CTTCCGGCGG GAGGAGCGGG GCAAACCGGA GTTCGTGCAC      1140
     ACGCTGAACG GCTCCGGCCT CGCCATTGGG CGCACGGTGG CGGCCATCCT GGAGAACTAC      1200
     CAACAGGAGG ACGGATCGGT CCTCATTCCG CGCGCGCTCG TGCCGTACAT GGGCGGGATC      1260
     GAGCGGATTG CGAAGGGCTG A                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page