(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE16

ALIAD_1.PE16         Location/Qualifiers
FT   CDS_pept        21114..22826
FT                   /locus_tag="Aaci_0016"
FT                   /gene_family="HOG000054766" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09818"
FT                   /codon_start="1"
FT                   /product="ABC transporter, ATPase, predicted"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter, ATPase, predicted; KEGG:
FT                   dat:HRM2_34010 ATPase family protein"
FT                   /db_xref="GI:258510036"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="GeneID:8423477"
FT                   /translation="MEALRRHLQSIDGRGYKAYQDLEGRYAFPSFTLAVDHVQGDPFAD
FT                   PSKVRVLVLRGKTAVGDAWIDAPWRRIRCEDLLARRMDEALRRLPNRARGTGKSGLIAI
FT                   DAPGQKVLERTAVQIGRDEIVICLSVGLPAVGRRVLAREAEAMLFEQIPAAVERAVYGL
FT                   REEEIRPAVELADQQEAIRRYLRDHGLVAFVANGSILPRESGVSDKPLRRGAVPFQSPP
FT                   ELEISIPVPHREEPLRGMGIRRGITLIVGGGFHGKTTLLEALEHGVYDHVAGDGREFVI
FT                   TDRGAVKIRAEDGRSVAQVDISPLIGTLPHGKDTTRFSTEDASGSTSQAASLVEMIEAG
FT                   ATAFLIDEDTSATNLLVRDARMQALVAKSGEPITPYVDKARQLFDEYGISTVLVVGGLG
FT                   DYFDIADCVIKMEAYVPHDVTAEAKRVAAAIPTARKPEGGHAFGAIRQRVPQPDSLNSQ
FT                   RGHKAKVAARGRYAIQYGATEISLHALEQLVDDSQTRAIAAALSYMERKGWLTKALTVR
FT                   EILDAMEAQWDRDGLGSISLRQGHPGDLARPRRYELAAALNRLRTLRCEQRSE"
FT                   /protein_id="YP_003183470.1"
     ATGGAGGCGC TGCGGCGCCA CCTGCAATCC ATCGACGGCC GCGGGTACAA GGCGTATCAG        60
     GACCTCGAAG GGCGTTACGC CTTCCCTTCG TTCACCCTCG CCGTCGATCA CGTCCAGGGC       120
     GATCCGTTCG CGGATCCGTC CAAGGTGCGG GTTCTTGTGC TGCGGGGCAA GACCGCCGTC       180
     GGGGACGCGT GGATCGATGC GCCTTGGCGC CGAATCCGGT GTGAAGACCT CTTGGCGCGG       240
     CGGATGGACG AGGCGCTGCG CCGCTTGCCG AATCGGGCAC GCGGGACGGG GAAAAGTGGG       300
     CTTATCGCCA TCGACGCGCC GGGGCAGAAG GTGCTGGAGC GAACGGCGGT GCAGATTGGG       360
     CGGGACGAGA TCGTCATCTG CCTGTCCGTC GGTCTGCCGG CCGTCGGCAG GCGCGTGTTG       420
     GCGCGGGAAG CCGAGGCGAT GCTCTTCGAG CAGATTCCCG CAGCCGTGGA GCGCGCCGTG       480
     TACGGCCTGC GCGAGGAGGA GATCCGCCCC GCGGTGGAAC TGGCGGATCA GCAGGAGGCC       540
     ATTCGCCGGT ATTTGCGCGA TCACGGCCTC GTGGCTTTTG TCGCCAACGG CTCCATCCTG       600
     CCGCGCGAGA GCGGCGTGAG CGACAAGCCG CTGCGCCGGG GCGCGGTGCC GTTTCAGAGC       660
     CCGCCCGAGT TGGAGATCTC CATCCCCGTG CCGCACCGCG AAGAGCCGCT TCGAGGCATG       720
     GGCATCCGCC GCGGCATCAC GCTCATCGTC GGCGGCGGCT TCCACGGCAA GACGACGCTC       780
     CTCGAGGCGC TGGAGCATGG CGTGTACGAT CACGTCGCGG GCGACGGGCG CGAGTTCGTC       840
     ATCACCGACA GGGGCGCGGT CAAGATCCGC GCCGAAGACG GGCGGAGCGT GGCCCAGGTC       900
     GACATCTCTC CGCTCATCGG CACGCTTCCG CATGGCAAGG ACACGACGCG CTTCTCGACG       960
     GAGGACGCGA GCGGGAGCAC CTCGCAGGCG GCAAGCCTCG TCGAGATGAT CGAGGCGGGC      1020
     GCCACGGCGT TTCTCATCGA CGAGGACACG AGCGCGACGA ACCTCCTCGT CCGCGATGCG      1080
     CGCATGCAGG CGCTGGTGGC GAAATCGGGC GAGCCCATCA CGCCCTACGT CGACAAGGCG      1140
     AGGCAGCTGT TCGACGAATA CGGCATCTCC ACCGTGCTCG TCGTCGGAGG ATTGGGTGAT      1200
     TACTTCGACA TCGCCGACTG CGTCATCAAG ATGGAGGCGT ACGTCCCGCA CGATGTGACC      1260
     GCGGAGGCCA AACGCGTGGC TGCCGCCATC CCCACCGCCC GCAAGCCGGA AGGTGGGCAT      1320
     GCGTTCGGGG CCATCCGCCA GCGCGTCCCC CAGCCCGACA GCCTCAACAG CCAGCGGGGC      1380
     CACAAGGCGA AGGTGGCGGC GCGCGGGCGA TATGCCATCC AATATGGCGC CACGGAGATC      1440
     TCCCTGCACG CGCTGGAGCA ACTCGTCGAC GACAGCCAGA CGCGCGCCAT TGCGGCGGCC      1500
     CTCTCGTACA TGGAGCGGAA GGGCTGGCTG ACGAAGGCGC TCACGGTTCG AGAGATCCTC      1560
     GACGCCATGG AGGCGCAGTG GGATCGGGAC GGGCTGGGAT CCATCTCTCT CCGCCAAGGC      1620
     CATCCGGGCG ATCTCGCCCG CCCACGCCGG TACGAGCTCG CAGCCGCGCT CAATCGGCTG      1680
     CGGACGCTGA GGTGTGAGCA GCGGAGCGAA TGA                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page