(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE19

ALIAD_1.PE19         Location/Qualifiers
FT   CDS_pept        complement(26460..26741)
FT                   /locus_tag="Aaci_0019"
FT                   /gene_family="HOG000130865" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0150"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   dvl:Dvul_2770 hypothetical protein"
FT                   /db_xref="GI:258510039"
FT                   /db_xref="InterPro:IPR005357"
FT                   /db_xref="GeneID:8423481"
FT                   /translation="MATRGYPAIFDPYEDGSFVVLFPDFPGCVTQGCNLDDAVAMAEEA
FT                   LTLQLYGIERDGEDLPEPSDPSHVTVPEEVQGQWFVMLIHPRPELFHP"
FT                   /protein_id="YP_003183473.1"
     atggccacac gaggataccc tgcgattttc gacccatacg aagatggatc cttcgtcgta        60
     ttgtttcccg actttcctgg gtgcgtcacg cagggctgca accttgatga cgccgtagcc       120
     atggcagaag aagcactcac acttcagctc tatggaattg aacgcgacgg agaggatcta       180
     cctgaacctt cagatccctc gcacgtaacg gtcccagaag aagtgcaggg acaatggttt       240
     gtcatgctca tccatccacg ccctgagtta ttccatccgt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page