(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE20

ALIAD_1.PE20         Location/Qualifiers
FT   CDS_pept        27889..29079
FT                   /locus_tag="Aaci_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510040"
FT                   /db_xref="GeneID:8423483"
FT                   /translation="MSSRRWLVAGFFAPIVVICIFMFTFIPAVRSAGERLSELKVAVVN
FT                   EAGSQGVALQKQLAKHLPFTAITGLDERAARQKLLTGNVEMVIRIPSDFYEKLASGNAH
FT                   LDFELTDALSPNVKSMMQLTEARVTQATNAAVLEVAKWKLDNALMKQVDVAPANTSQSK
FT                   EVAVSAAQREVFLVKLMQQIQRFPTQPVRANEVVVASAPAVAEFLPFLTVVTFFIGSIL
FT                   ASLAAWFALKPFDGSARRRYMAWFETLGYILIVSFAAAATVVGVAQMYGVYPVVHAFRA
FT                   VCSLAISFGAGCGLVGGLIYLLRLPGIGLYALLFPFQMLSSGIALPFDMLPQGYQSVVR
FT                   VLPALHVTRVVNWLYVGVGDVSADLKWLGLTVLLAALVMGLRLVFVRRRQVKEDSI"
FT                   /protein_id="YP_003183474.1"
     ATGTCCTCGA GGCGTTGGCT GGTCGCAGGG TTCTTCGCAC CGATAGTTGT TATATGTATC        60
     TTCATGTTCA CTTTTATTCC AGCTGTGCGT AGTGCAGGGG AGCGTTTGTC TGAGCTGAAG       120
     GTCGCAGTTG TCAATGAGGC TGGGTCGCAA GGGGTAGCAT TGCAGAAACA GCTGGCTAAA       180
     CACCTGCCTT TCACGGCCAT CACGGGTCTA GACGAGCGGG CGGCGCGCCA AAAGTTACTG       240
     ACTGGAAATG TCGAAATGGT TATTCGCATT CCATCTGATT TCTACGAGAA ACTCGCAAGT       300
     GGCAATGCTC ATCTAGATTT TGAACTGACG GACGCCTTGT CGCCAAACGT AAAAAGTATG       360
     ATGCAATTGA CTGAGGCACG GGTGACACAA GCGACGAACG CAGCTGTGTT GGAAGTTGCA       420
     AAATGGAAAC TGGATAACGC GCTCATGAAG CAGGTGGATG TCGCACCTGC GAACACCTCC       480
     CAGTCAAAGG AAGTGGCAGT GTCGGCGGCG CAGAGAGAGG TCTTCTTGGT TAAGCTCATG       540
     CAACAGATTC AGCGGTTTCC GACGCAGCCT GTCCGTGCAA ACGAAGTGGT AGTAGCATCA       600
     GCACCCGCCG TGGCGGAGTT TCTTCCCTTC CTCACGGTGG TGACATTTTT CATTGGAAGC       660
     ATCCTTGCAT CTTTAGCTGC TTGGTTTGCA CTGAAACCTT TCGACGGATC TGCACGGCGA       720
     AGGTACATGG CGTGGTTCGA AACGTTAGGG TATATCCTCA TTGTATCGTT TGCAGCGGCT       780
     GCAACCGTCG TCGGAGTCGC GCAAATGTAC GGCGTGTATC CCGTCGTTCA CGCCTTTCGC       840
     GCGGTATGTA GCCTTGCCAT CTCGTTCGGC GCTGGTTGTG GATTGGTGGG AGGGCTCATT       900
     TACCTGCTCA GACTCCCTGG AATCGGGTTG TATGCTCTGT TGTTTCCTTT TCAAATGCTG       960
     TCATCCGGAA TTGCCCTGCC ATTTGATATG CTACCGCAAG GATACCAGAG CGTCGTCCGC      1020
     GTTCTGCCAG CGTTGCACGT CACCCGGGTG GTGAACTGGC TGTATGTAGG TGTCGGGGAC      1080
     GTGAGCGCAG ACCTGAAGTG GCTTGGCTTG ACGGTTCTAC TGGCTGCCTT GGTCATGGGA      1140
     TTGCGGCTGG TCTTTGTACG CAGGCGACAG GTAAAAGAAG ACAGCATCTA G               1191
//

If you have problems or comments...

PBIL Back to PBIL home page