(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE21

ALIAD_1.PE21         Location/Qualifiers
FT   CDS_pept        29487..30161
FT                   /locus_tag="Aaci_0022"
FT                   /gene_family="HOG000271974" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce0067
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:258510041"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:8423484"
FT                   /translation="MSERMDQWLTELVRLNEDDRVTDRQLNILRAAVEVFAEKGFAAAS
FT                   TSEIAQRAGVAEGTIFRHYKTKKDLLLSITVPVIDEFVGPFLLRDLETILTAQHERFED
FT                   FLRAVLFNRLQFAKKYAQVLRILAQEIPFHPELKAQLKQYVTENVLKRLVGIIEHFQEK
FT                   GEIARIPARTVIRLTVSVILSHVVLRHILFHDAPWRDDEEIEMTVRFIVQGLRPDASRD
FT                   QK"
FT                   /protein_id="YP_003183475.1"
     ATGTCCGAGC GAATGGACCA GTGGTTGACC GAGTTGGTGC GTCTAAACGA GGATGACCGC        60
     GTGACCGACC GACAATTGAA CATCTTACGC GCGGCGGTGG AAGTGTTCGC GGAGAAGGGT       120
     TTTGCTGCTG CGTCCACGAG CGAGATCGCA CAGCGGGCAG GCGTGGCCGA AGGCACCATC       180
     TTCAGACACT ATAAGACAAA GAAGGATTTG CTTCTTTCCA TCACGGTACC GGTGATCGAT       240
     GAATTTGTCG GACCGTTCTT GCTCCGAGAT CTCGAGACCA TTCTTACTGC CCAACACGAA       300
     CGGTTTGAAG ACTTTCTACG AGCCGTATTG TTTAACCGCT TGCAATTTGC AAAGAAATAT       360
     GCTCAAGTTC TGAGGATTTT AGCTCAAGAA ATACCTTTTC ATCCCGAGTT GAAGGCGCAA       420
     CTCAAGCAAT ATGTCACCGA GAATGTGTTG AAGCGCCTAG TCGGGATTAT TGAACACTTT       480
     CAGGAAAAAG GGGAGATTGC GCGGATTCCC GCGCGGACTG TGATCCGGCT AACGGTGTCA       540
     GTCATCCTAA GCCATGTGGT GTTGCGTCAC ATCCTGTTTC ACGATGCACC CTGGCGAGAT       600
     GATGAGGAAA TTGAGATGAC TGTTCGTTTC ATTGTGCAGG GTTTAAGGCC GGACGCGAGC       660
     AGAGACCAGA AATAA                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page