(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE22

ALIAD_1.PE22         Location/Qualifiers
FT   CDS_pept        complement(30921..31895)
FT                   /locus_tag="Aaci_0023"
FT                   /gene_family="HOG000246674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.41"
FT                   /transl_table="11"
FT                   /note="KEGG: xca:xccb100_3342 3-oxoacyl-(acyl carrier
FT                   protein) synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; 3-Oxoacyl-[acyl-carrier- protein (ACP)] synthase
FT                   III"
FT                   /db_xref="GI:258510042"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="GeneID:8423485"
FT                   /translation="MYKAVIRGVGSYLPETRLTNVEIEQMVATSDEWIQTRTGIAERRI
FT                   ARPDEATSDFAYLAAQAALADAKLHPTDIDLLIVATETPDYLLPPVACQVQARLGCRNI
FT                   GAFDLHATCAGFLSALQVAEQFVKSGVHEHVLIVGADTLSRFTDYTDRGTCILFADGAG
FT                   AFVVSRSDDRAARGVIATTIHSDGTYFHNLYIPGGGSRTPYGDGAKAKIVMDGRKIFKL
FT                   AVNVMSSTVEELLQKTGRQRDEIDWLIPHQANQRIIDAVAESLDFPQEKVVSTIQNIGN
FT                   NSSATIPIAVDTAIRDGRIQRGDLLMLVAFGGGLVWGGAMVEY"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /protein_id="YP_003183476.1"
     ttgtacaagg ccgtgattcg cggcgtgggc tcctacctgc cggagacgcg cctgaccaat        60
     gtcgaaattg aacagatggt ggcaacgtcc gacgagtgga ttcagacccg cacaggcatt       120
     gccgagcggc ggattgcgcg gcctgacgag gccacctcgg actttgccta cctcgcagcc       180
     caggcggcgc tcgccgacgc aaagctccat ccgacggaca tcgatctgct catcgtggcc       240
     acggagaccc cggactacct gttgccgccc gtcgcctgtc aggtgcaggc gaggcttggc       300
     tgccggaaca tcggcgcgtt tgatcttcac gccacgtgcg cgggcttctt gtctgcgctc       360
     caggtggcgg agcagttcgt gaaatcgggc gtgcacgagc acgtcctcat cgtcggcgcc       420
     gacacgctgt cgcgcttcac ggattacacg gatcgcggca cgtgcatcct gttcgccgac       480
     ggcgccggcg cgtttgtcgt ctcgcgcagc gacgatcggg ccgcccgcgg cgtgatcgcc       540
     acgaccatcc attcggacgg cacctacttc cacaacctgt acatccccgg gggcggaagt       600
     cggacgccct atggcgacgg cgcgaaggcc aagattgtga tggacgggcg caaaatcttc       660
     aagctggccg tgaacgtgat gtcctccacg gtcgaagagc tgttgcagaa gaccgggcgg       720
     cagagggacg agatcgactg gctcatcccg caccaggcca accagcggat catcgacgcg       780
     gtggcggaaa gcctcgattt tccgcaggag aaggtcgtga gcaccatcca gaacatcggc       840
     aacaactcgt cggcgacgat ccccattgcg gtggacaccg ccatccgcga cgggcgcatc       900
     cagcgcggcg atctgctgat gctggtggcg ttcggcggcg gcctggtgtg gggcggcgcg       960
     atggtggagt attga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page