(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE23

ALIAD_1.PE23         Location/Qualifiers
FT   CDS_pept        32061..32999
FT                   /locus_tag="Aaci_0024"
FT                   /gene_family="HOG000005595" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /codon_start="1"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /transl_table="11"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   mxa:MXAN_3034 putative ADP- ribosylglycohydrolase"
FT                   /db_xref="GI:258510043"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="GeneID:8423486"
FT                   /translation="MIALHDRLRGGMWGLLVGDALGEPYVGLQPEEIPPEGEIDMKGPP
FT                   GEWVAVVPPGTWTDDGAQALCLLDSLLTCGRFDPADFAARLIAWHDEGLWTVDGQAFGI
FT                   GWQTKLAIQEMKRGVEPERAGNVRPEGKGNGALMRVLPLALWHRGDDAALVEDAHRQAR
FT                   VTHGHITNQVCCAVYCLWARRILDGQARGEAYEGAIAALRGLYGEDSPYRRSLEQEVRP
FT                   DDPPVTNGDGYVVHTLNAARLALEETSYERVVRRAIQLGRDTDTNAAVAGGLAGVAFGA
FT                   SGIPERWRRQLRGRDMAEPLVESLVRWRLGS"
FT                   /protein_id="YP_003183477.1"
     ATGATCGCAC TTCACGACAG GTTGCGCGGC GGCATGTGGG GGTTGCTTGT GGGTGATGCG        60
     CTCGGCGAGC CCTATGTCGG ACTTCAACCC GAGGAAATAC CGCCTGAGGG CGAAATTGAC       120
     ATGAAGGGGC CGCCTGGGGA ATGGGTGGCC GTGGTGCCAC CGGGCACTTG GACCGACGAT       180
     GGTGCGCAGG CGCTGTGTCT GCTCGACTCG CTTCTCACGT GCGGTCGGTT CGATCCGGCG       240
     GATTTCGCCG CGCGGCTCAT CGCGTGGCAT GACGAAGGCC TTTGGACGGT GGACGGACAA       300
     GCATTTGGCA TTGGGTGGCA GACAAAACTG GCCATTCAGG AGATGAAGCG CGGCGTGGAA       360
     CCGGAACGCG CGGGCAATGT GCGGCCGGAG GGGAAGGGCA ACGGCGCGCT GATGAGGGTC       420
     CTGCCGCTCG CGCTGTGGCA TCGGGGAGAT GATGCTGCGC TTGTTGAAGA TGCGCACCGG       480
     CAGGCGCGCG TGACGCACGG TCATATCACC AACCAGGTGT GCTGCGCCGT CTACTGCCTG       540
     TGGGCTAGGC GAATCTTGGA TGGGCAGGCG CGGGGTGAAG CGTACGAGGG TGCCATCGCG       600
     GCGCTGCGCG GCCTTTACGG GGAGGATTCT CCCTACCGCC GGTCTCTGGA ACAAGAGGTG       660
     CGTCCAGACG ATCCGCCTGT CACGAACGGC GACGGCTACG TCGTGCACAC GCTCAACGCG       720
     GCTCGCCTGG CCCTTGAAGA GACAAGCTAC GAGCGGGTGG TCAGGCGCGC CATTCAGCTC       780
     GGCCGCGACA CGGACACCAA CGCGGCTGTG GCGGGCGGAC TCGCCGGCGT CGCGTTCGGA       840
     GCGTCGGGCA TCCCCGAAAG GTGGCGTCGC CAGCTCAGGG GGCGGGACAT GGCGGAACCG       900
     CTCGTCGAGT CGCTCGTGCG ATGGCGCCTC GGCTCTTGA                              939
//

If you have problems or comments...

PBIL Back to PBIL home page