(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE25

ALIAD_1.PE25         Location/Qualifiers
FT   CDS_pept        complement(34001..35365)
FT                   /locus_tag="Aaci_0026"
FT                   /gene_family="HOG000029894" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG0438"
FT                   /codon_start="1"
FT                   /product="Glycosyltransferase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: azo:azo3253 hypothetical protein"
FT                   /db_xref="GI:258510045"
FT                   /db_xref="GeneID:8423488"
FT                   /translation="MKRRHALIICHDFPPVGGIAVQRPLKFAKYLGEFGWKVTVLTADH
FT                   VYSATPDPSLLDEIPGDVQIVRVTDPVSKQLARWSGRIVGDGSTPAPQASAQARLPLWK
FT                   RLAWGAWKWAQEHALIPDESVVWAIRAGFAARRIVRQRVMDCIYTTSGPQSTQLAGLIA
FT                   SAFTRTPWIADFRDPWTDNLHFHHRGWRAALERRLERMVFARAAAIVTVTDGFWRLFAA
FT                   KYPRRALDIHVIRNGVDEADFPPAPARRRSEGEPFTFFYGGILYSGRSADALFQAVHRL
FT                   LQSGHIAPHRIRIQFAGVLDYPGHHHHARLIRELGLEAVIEPLGYLPRREALARMLAAD
FT                   ATLLIGDQSEQAKDYVPGKLYEYLYAGRPILAMLREGEAADLIRREQAGIIVPPDDPDA
FT                   IAQAMLHLMAQPATERRAWNPAYSRRAQAQQLARLMDDVLAVQTESTAWSMSWDG"
FT                   /protein_id="YP_003183479.1"
     atgaagcgcc gccacgccct tatcatctgc cacgacttcc cgccggtcgg cgggatcgcc        60
     gtgcagcggc cgctcaaatt tgccaagtat ctcggggaat tcggttggaa ggtcaccgtg       120
     ctcacggccg atcacgtcta cagtgcgacg cccgatccgt cgctcctcga cgagatccct       180
     ggggacgtgc agattgtgcg cgtcacggat cctgtatcca aacagctcgc gcgctggtcg       240
     gggcgcatcg tgggcgatgg ctcgacgccc gcgccgcagg cgtccgccca ggcgcggctc       300
     cccctgtgga agcgactcgc ctggggcgcg tggaagtggg cccaagagca cgcgctcatt       360
     ccggacgaat ccgtggtgtg ggcgattcgg gcgggcttcg cggcccggcg catcgtgcgg       420
     cagcgcgtca tggactgcat ctacacgacc tcggggccgc agagcacgca gcttgcaggc       480
     ctcatcgctt cggcgttcac gcggacgccc tggattgcgg actttcggga tccgtggaca       540
     gacaacctgc acttccacca ccgcgggtgg cgcgccgccc ttgagcggcg gctcgagcgc       600
     atggtcttcg cccgcgcagc ggccatcgtg acggtcacag acggcttctg gcggctgttc       660
     gcggccaaat acccgcgtcg cgcgctcgac atccacgtca ttcgaaacgg cgtggacgag       720
     gcggactttc cgcccgcgcc cgccaggcgg cgcagcgaag gggagccgtt cacgttcttc       780
     tacggcggca tcctgtactc cggccgatcc gccgacgccc tgtttcaggc cgtgcatcgc       840
     ctgcttcaga gcgggcacat cgcaccccat cgcatccgca ttcagttcgc gggcgtgctt       900
     gactaccccg gccatcatca ccacgcgcgc ctcatccggg agcttgggct tgaggccgtg       960
     atcgagccgc tcggctacct cccgcgccgc gaggcactcg cccgcatgct ggccgccgac      1020
     gcgacgcttc tcatcggcga tcagtccgag caggccaagg actacgtccc cggcaagctg      1080
     tacgagtacc tgtacgccgg acgccccatc cttgccatgc tccgcgaagg cgaagccgcc      1140
     gatctcatcc gccgcgagca ggccggcatc atcgtgccgc cggacgatcc cgacgccatc      1200
     gcgcaggcca tgctccatct catggcgcag cctgccaccg agcggcgcgc gtggaatccg      1260
     gcctacagcc gccgcgcgca ggcgcagcaa ctcgcccgcc tgatggacga cgtgctggcg      1320
     gtccaaaccg agtccaccgc ctggtccatg tcctgggatg ggtga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page