(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE26

ALIAD_1.PE26         Location/Qualifiers
FT   CDS_pept        complement(35362..36729)
FT                   /locus_tag="Aaci_0027"
FT                   /gene_family="HOG000153774" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.22"
FT                   /transl_table="11"
FT                   /note="KEGG: ent:Ent638_3999 UDP-N-acetyl-D-mannosamine
FT                   dehydrogenase; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase; UDP-
FT                   glucose/GDP-mannose dehydrogenase dimerisation; UDP-
FT                   glucose/GDP-mannose dehydrogenase ; 6-phosphogluconate
FT                   dehydrogenase NAD-binding"
FT                   /db_xref="GI:258510046"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="GeneID:8423489"
FT                   /translation="MRTQIAVIGLGYIGLPLSLALCERGETVIGVDVDERKVNELRAGV
FT                   THVMEPYRGESLESILRRHLESARFTATTSLAEAAERADTFIVTVGLPVAGDVVDKTLL
FT                   LACVNDLGRALSPGDLVLIRSTLVPGMMEGEIVPRLASTSGLVPGRDFHVAYAPERVAE
FT                   GRAMEEFQTLDVVVAGLTDACADRAMAVLARLTDGRLHKTSLRVAELSKVVENAQRDVN
FT                   IALAHELKVVAEQHGVDVYELIRMANTHPRVHLLEPNIGVGGFCIPNAYAYLAASLTSE
FT                   EHIPLFSLARQINLTAPHRAARQLDEALRQIGKRLSGARVALLGLGMKDGSNDIRQSPA
FT                   IHFAEILAERGAAVTAFDPTVDPYFPFQAPSLEDCLANADAVAVAAWQAEFDTAPWPDL
FT                   LARARQPLAVLDLKRRLVPSLKQAGWQIRGDSHLPYIAVSAPHVSATRDCAVEMVP"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /protein_id="YP_003183480.1"
     atgcgcacgc agatcgcagt cattggactt ggctatattg gcttgccgct ctccctcgcg        60
     ctctgtgagc gcggcgagac ggtcatcggc gtcgacgtgg acgagcgcaa ggtgaacgag       120
     ctccgcgccg gcgtgacgca cgtgatggag ccgtaccgcg gcgaatccct cgaaagcatc       180
     ctgcgccggc acctcgaaag cgctcggttc accgccacaa catcgctggc cgaagccgcc       240
     gagcgcgccg acacgttcat cgtcaccgtc ggccttccgg tggcgggcga cgtcgtcgac       300
     aaaacgctcc ttctcgcctg cgtcaacgac ttgggccgcg ctctttcccc gggcgatctc       360
     gtcctcatcc gcagcacgct tgtccccggc atgatggagg gcgaaattgt cccccgcctc       420
     gcttcgacga gcggcctcgt tccgggcagg gacttccacg tggcctacgc gccggagcgg       480
     gtcgccgagg gccgcgcgat ggaagagttc cagaccctcg atgtcgtcgt ggcgggcctg       540
     acagacgcgt gcgccgatcg cgccatggct gtgctcgccc gcctcacgga cggtaggttg       600
     cacaagacga gccttcgcgt cgccgaactg tccaaagtcg tggaaaacgc gcagcgcgac       660
     gtcaacatcg ccttggcgca cgagctcaag gtggtcgccg agcagcacgg cgtggacgtg       720
     tacgagctca tccgcatggc caacacgcat ccgcgcgtgc acctgctcga gccgaacatt       780
     ggcgtcggcg gcttctgcat ccccaacgcg tacgcgtacc tcgcggcttc gctcacatcg       840
     gaagagcata tcccgctctt ttcactggct cgccaaatca acctgacggc gccgcaccgc       900
     gccgcgcgcc aacttgacga ggcactgcgc cagattggca agcggctttc gggcgcgcgt       960
     gtggcgcttc tgggccttgg catgaaggac ggatcgaacg acatccgcca aagcccggcc      1020
     atccacttcg ccgagatcct cgccgagcgc ggcgccgcgg tgacggcgtt cgatccgacg      1080
     gtcgatccgt acttcccctt ccaggcgccg tcgctcgaag actgcctggc gaacgcggat      1140
     gccgtggccg tcgccgcgtg gcaggcggag tttgacacag cgccttggcc ggaccttctc      1200
     gcccgcgccc ggcagccgct cgccgtgctg gatctcaagc gccgcctcgt accaagtctg      1260
     aaacaggcgg gctggcagat ccgcggcgac agccacctgc cctacatcgc cgtctcggcc      1320
     ccacacgtat ccgccacgcg agattgcgcg gtggagatgg tgccatga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page