(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE28

ALIAD_1.PE28         Location/Qualifiers
FT   CDS_pept        complement(40643..41866)
FT                   /locus_tag="Aaci_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sfu:Sfum_2384 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:258510048"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:8423491"
FT                   /translation="MRTYGWYRRRSLALLMVADGISVLGDQVGWMGLLWSTMTLTKNAQ
FT                   IMGWLGLAFGLPAVALGPTVGHVLDHTPHKRALITSHVMLGALFASIAVLERLHVLPVW
FT                   ALLMFAIAAGCLTPFSTIGWSVVIPNIVADDELGSVNALMEILWNGAAILGPALGGFAI
FT                   ARVGSSAALFADAISFWLAALCVGMAKVPAQARHAPMTKCQVARSFVQNTLEAMKTLYA
FT                   LRPVWWITIGAWALNLAYGALDIELPLLTHRQFGRGAWILGSLWSTYAISSIAGAAFSG
FT                   WMSKRRRTGVVMAMMIIGWGAAFAPLFWIHAFTLIYVFLACAGLLFGGYPPLARTVVQR
FT                   SVPTQVMGRIMGLRGSLIALGPPLGSWVGGVLDRWLSPSDAISLVGMAVVALGCWLGSR
FT                   SDFWRIEA"
FT                   /protein_id="YP_003183482.1"
     atgagaacat acgggtggta ccgacgtcgc agtctggcac tgttgatggt ggcggatggg        60
     atttcggtct tgggcgatca ggtgggctgg atggggcttt tgtggtccac gatgaccctg       120
     accaagaacg cgcagatcat gggatggctg gggcttgcct tcggcctgcc agccgtcgcg       180
     ctcggcccca ccgttgggca cgtcttggac cacacaccgc acaaacgggc gctcatcaca       240
     tcccacgtca tgctcggcgc tttgttcgca tccatcgccg tgctggaacg tctgcacgtg       300
     cttcctgtgt gggcgcttct gatgttcgcg attgcggcag gctgccttac gccgttttcg       360
     accatcggct ggagcgtcgt cattccaaat attgtcgcgg atgatgagct tggctccgtc       420
     aatgcgctca tggagatcct gtggaacggc gcagccattc tgggaccggc ccttggcgga       480
     ttcgccatcg cgcgcgtagg tagctccgcg gccttgttcg cggacgcaat ttcgttttgg       540
     ctcgcggcgc tatgtgttgg aatggcgaag gtacccgcgc aggcgaggca tgcgccgatg       600
     acgaagtgtc aagtggcgcg atcgtttgtg caaaacaccc tcgaggccat gaagacgttg       660
     tacgcgctgc gtccggtctg gtggatcacc atcggcgcgt gggcgctcaa tctggcgtac       720
     ggcgcgcttg acatcgagtt acctctcctg acacaccgac agtttggtcg aggtgcctgg       780
     atcctaggca gcctttggtc cacctatgcc atcagctcca ttgctggagc ggcgttcagt       840
     ggctggatgt ccaagagacg caggaccggc gtagtcatgg cgatgatgat catcggatgg       900
     ggcgcggcgt tcgcgccgct gttctggatc cacgccttca cgctcatcta cgtgttcctc       960
     gcctgcgccg gactcctgtt tggcgggtat ccaccgctgg cgcggaccgt cgtccagcgc      1020
     tctgtgccga cgcaggtcat gggacgcatc atgggcctac ggggctcact gattgcactt      1080
     ggtccgcctc tcggctcgtg ggtcggcggc gtgttggata gatggctcag tccgtcggac      1140
     gccatctccc tggtcggtat ggccgttgtg gcactcggat gctggcttgg ctcacggagt      1200
     gacttttgga ggatagaagc ttaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page