(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE30

ALIAD_1.PE30         Location/Qualifiers
FT   CDS_pept        complement(43017..44090)
FT                   /locus_tag="Aaci_0031"
FT                   /gene_family="HOG000010341" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG: scl:sce7757
FT                   ABC transporter permease"
FT                   /db_xref="GI:258510050"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:8423493"
FT                   /translation="MKALQSILLPVAASLVAIAIGAILVAALGYNPVSVYGSLISGAFG
FT                   NLGNLGNTLTASLPLIIIGLGIAISFQSGLFNIGADGQYWIGATAAVWVGYHFTSLPGW
FT                   LHMLFCLVAGMIAGALWAGIVPGLTKAFVGAHEVITTMMMSYIAILFARYLIEGGPMQE
FT                   KGYIPQSPLIASNTQFPYFTQGFARSQLSPISMLIAALAVIVAWFLLYKTTLGFSLRSV
FT                   GLNARAAKYAGIRVKLHIVIALALSGLFAGLAGAVQMLGVDHQLLDGFSSNYGYTAIVV
FT                   ALLARNNPLAVVISGLFFGALTTGGQNMQIVSNVPASLTNVLTGLIIFFVGCERIIPQV
FT                   IGWYRRRRSTRAQTPAS"
FT                   /protein_id="YP_003183484.1"
     gtgaaggcgc ttcagtcgat tctcttgccc gtggccgcga gcctggtggc catcgccatc        60
     ggtgccatcc tggtggcggc gctcgggtac aatccggtgt ccgtgtacgg atcgctcatc       120
     tcgggcgcgt tcggcaatct cggcaatttg ggcaatacgc tcacggcgag cctaccactc       180
     atcatcatcg ggcttggcat tgccatctcg tttcagagcg ggctgttcaa catcggcgcg       240
     gacggccagt actggatcgg cgcgacggcg gcggtctggg tgggttacca cttcacgtcc       300
     ctgcccggct ggctgcacat gctcttctgc ctcgtcgccg gcatgatcgc gggcgcgctg       360
     tgggcaggca tcgtgcccgg gctcacgaag gcgttcgttg gcgcgcacga ggtcatcacc       420
     accatgatga tgagttacat cgcgattttg ttcgcacgct acctcattga gggcgggccg       480
     atgcaggaga aggggtatat cccccagtcg ccgctcatcg cgtcgaacac ccaatttcct       540
     tatttcacgc aagggtttgc gcgatcccag ctgtcgccca tctccatgct catcgcggcg       600
     ctcgccgtga tcgtcgcgtg gttcctgctg tacaagacga cgctcggatt ttccctgcga       660
     tccgtcggcc tgaacgcgcg cgcggcgaaa tacgccggca tccgcgtcaa gttgcacatc       720
     gtgatcgcgc tcgcgctgtc ggggctcttc gccggcctgg cgggggcggt gcaaatgctc       780
     ggcgtcgatc atcagctgct cgatggcttt tcgtcgaact acggctacac ggccatcgtg       840
     gtggcgcttc tcgcgcgcaa caacccgctc gccgtcgtca tctcgggcct ttttttcggc       900
     gcgctgacca cgggcggtca gaacatgcag attgtctcca acgtcccggc ttcgctcacc       960
     aatgtgctga ccggactcat catcttcttt gtcggatgtg aacgcatcat cccgcaggtg      1020
     atcggttggt atcggcggcg ccgctccacg agagcccaga cgcccgcaag ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page