(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE32

ALIAD_1.PE32         Location/Qualifiers
FT   CDS_pept        complement(45683..46753)
FT                   /locus_tag="Aaci_0033"
FT                   /gene_family="HOG000010227" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /codon_start="1"
FT                   /product="basic membrane lipoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   mxa:MXAN_5711 Bmp family lipoprotein"
FT                   /db_xref="GI:258510052"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="GeneID:8423495"
FT                   /translation="MQKRIWQSGLSILAAAALVVGCGTNNSSSATNTSNNGSTGNTTST
FT                   SGKTIKVGLVTDTGGLNDNSFNHLAYVGMQEAQKELPNIQTSVVQSQSESDYVPNLSHF
FT                   AQDGYDLVIAVGYLMADAVQQVAKEYPKTHFLIIDDSITGIPNVASAIFQSQQAGYLAG
FT                   VVAGMVQKNHLLKNINSHNTVGVVGGQEIPPVDTYIAGFQQGFHSVDPTGKVIVEYTNS
FT                   FSDEAAGSQYAQNEIAQGADIIFPVAGGTGIGSIKAAQSAKVYAIGVDTDQSYLAPGTV
FT                   ITSAIKRVDTSVFDTIKAVQDGTFKSGVNTFDLANNGVGIAPLISGLPKSVTDAVNQAK
FT                   QEILSGKIQVSATVQK"
FT                   /protein_id="YP_003183486.1"
     atgcagaagc ggatttggca gagcggcctc tccatcctgg ccgcggccgc cctcgtcgtg        60
     gggtgcggca ccaacaactc gtcgagcgct accaacacgt ccaacaacgg cagcacgggc       120
     aacaccacct cgacgagcgg caagaccatc aaggtcggcc tcgtgaccga caccggcggc       180
     ttgaacgaca acagcttcaa ccacctggcg tacgtcggca tgcaggaggc gcagaaagag       240
     ctgcccaaca tccagacgag cgtcgtccag tcccaatccg agtcggacta cgtcccgaac       300
     ctcagccact tcgcgcagga tgggtacgat ctcgtcatcg ccgtaggcta cctcatggcg       360
     gacgcggtgc aacaagtggc caaggaatac ccaaagacgc acttcctcat catcgacgat       420
     agcatcacag gcattccgaa cgtggcgagc gccatcttcc agtcgcagca ggccggttat       480
     ctcgcgggcg tggtcgccgg catggtgcag aaaaatcatc ttctgaagaa catcaacagc       540
     cacaacaccg tcggcgtggt cggaggccag gagatcccgc cggtggatac gtacatcgcg       600
     ggcttccagc aggggttcca cagcgtcgat ccgacgggca aggtcattgt cgaatacacc       660
     aactcgttca gcgatgaggc ggcgggcagc cagtacgcgc aaaacgaaat tgcgcagggc       720
     gccgacatca tcttcccggt ggctggcggc accggcatcg gctccattaa agccgcgcag       780
     agcgcgaagg tctacgccat cggcgtggac acggaccagt cgtatctcgc gcccggcacc       840
     gtcatcacga gcgccatcaa gcgggtggac acgtccgtgt ttgacaccat caaggccgtg       900
     caggacggca ccttcaagag cggcgtgaac acctttgatc ttgcgaacaa cggcgtcggc       960
     attgcgccgc tcatctcggg cctgccgaag tcggtgacgg acgcggtcaa ccaagcgaaa      1020
     caggagatcc taagcggcaa gattcaggta tccgccaccg tgcagaagtg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page