(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE33

ALIAD_1.PE33         Location/Qualifiers
FT   CDS_pept        47066..47635
FT                   /locus_tag="Aaci_0034"
FT                   /gene_family="HOG000078668" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /codon_start="1"
FT                   /product="isochorismatase hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bav:BAV0718
FT                   isochorismatase-family hydrolase"
FT                   /db_xref="GI:258510053"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="GeneID:8423496"
FT                   /translation="MASDVKQTALLVMDVQNGIVSRYIQDAPAMRPFQEAVSAARKAGI
FT                   QVIFVRVAFSEGFPEASPRNKMFAHLAQAGNMTVSADSTQIHESVRPEAGEPVVTKYRV
FT                   SAFAGSNLEVILRAKDITHLVLCGIATSGVVLSTLREAADKDYALIVLKDACLDADPEV
FT                   HRVLVEKVFPRQADVMTVEEWAKTLV"
FT                   /protein_id="YP_003183487.1"
     ATGGCATCGG ATGTGAAACA AACGGCGCTT TTGGTGATGG ACGTCCAGAA CGGCATCGTT        60
     TCGCGGTACA TCCAGGATGC ACCCGCCATG CGCCCGTTTC AGGAGGCCGT CTCGGCTGCG       120
     CGCAAGGCGG GCATTCAGGT CATCTTTGTG CGGGTGGCTT TCAGTGAAGG CTTTCCGGAG       180
     GCGAGCCCGC GCAACAAGAT GTTTGCGCAC CTCGCGCAGG CCGGCAACAT GACGGTGAGC       240
     GCCGACTCCA CGCAGATTCA CGAATCGGTG CGCCCAGAGG CGGGCGAGCC GGTGGTCACG       300
     AAGTACCGCG TCAGCGCGTT TGCCGGCAGC AACCTGGAGG TCATTCTGCG CGCCAAGGAC       360
     ATCACGCATC TCGTGCTCTG CGGCATCGCC ACATCGGGCG TGGTGCTCTC CACCCTGCGG       420
     GAGGCGGCGG ACAAGGACTA CGCGCTGATC GTGCTGAAAG ACGCCTGCCT GGACGCCGAT       480
     CCGGAGGTGC ACCGAGTGCT CGTGGAGAAG GTGTTCCCGC GGCAGGCCGA CGTCATGACC       540
     GTCGAGGAGT GGGCGAAGAC GCTCGTGTGA                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page