(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE34

ALIAD_1.PE34         Location/Qualifiers
FT   CDS_pept        47654..48286
FT                   /locus_tag="Aaci_0035"
FT                   /gene_family="HOG000058039" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bbt:BBta_2483 putative beta-lactamase"
FT                   /db_xref="GI:258510054"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="GeneID:8423497"
FT                   /translation="MEIAPKIHLLECTKGSYSYLVLGDEPVLVDTSMPGRADAMVKALA
FT                   SLGLKPGDLAHIVLTHLDVDHIGNAKRLKELSGATLWAPAPDIPYIEGAEKPKGVRRAI
FT                   AGLMRVERPKVDRALEPGAHVGGLEVVPAPGHTPGHVCLIARDTLLAGDLVTTRGGRLK
FT                   KSPSFLTWDKAALRQSLADVGRLSFDWVCPAHGDPVRRGSLWEALLE"
FT                   /protein_id="YP_003183488.1"
     GTGGAAATCG CGCCGAAGAT TCACCTGTTG GAGTGCACCA AGGGAAGCTA CAGCTACCTT        60
     GTGCTGGGCG ACGAGCCTGT GCTTGTCGAT ACCAGCATGC CTGGGCGGGC GGACGCGATG       120
     GTCAAGGCGC TCGCGTCCCT CGGCCTGAAG CCGGGCGATC TCGCCCACAT CGTCCTGACG       180
     CACCTGGACG TGGATCACAT CGGCAACGCC AAGCGGCTGA AGGAGCTCTC CGGCGCGACG       240
     CTCTGGGCAC CCGCGCCGGA TATTCCGTAC ATCGAGGGCG CCGAGAAGCC GAAGGGCGTG       300
     CGCCGCGCGA TTGCCGGGCT GATGCGCGTC GAACGGCCGA AGGTGGACCG CGCGCTCGAG       360
     CCAGGCGCAC ACGTGGGCGG CCTGGAGGTG GTACCCGCGC CCGGACATAC GCCCGGGCAC       420
     GTCTGCCTCA TCGCGCGCGA CACGCTTCTG GCGGGTGATC TCGTCACGAC CCGCGGGGGC       480
     CGACTGAAGA AGTCGCCGTC CTTCCTCACC TGGGACAAGG CGGCGCTCAG GCAGTCGCTC       540
     GCGGACGTGG GCAGGTTGTC GTTTGACTGG GTCTGCCCCG CGCATGGCGA TCCCGTCCGG       600
     CGCGGATCGC TGTGGGAGGC GCTGCTGGAG TAG                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page