(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE35

ALIAD_1.PE35         Location/Qualifiers
FT   CDS_pept        complement(48340..48759)
FT                   /locus_tag="Aaci_0036"
FT                   /gene_family="HOG000004135" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   sfr:Sfri_3970 thioesterase superfamily protein"
FT                   /db_xref="GI:258510055"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:8423498"
FT                   /translation="MIHETPIHIRYSDTDLNGHVNNAVYATYMEESRISFLQEVFPGQR
FT                   LPLVIASLHIDFRQETRYPEHTDVVARTWLTRLGRSSFEFFCQICSVRGEVMCEGTAVV
FT                   VHYDFEKRKSAPLPDWAREKLLPYVREPEESNVGV"
FT                   /protein_id="YP_003183489.1"
     ttgatccatg aaacgccgat tcatattcgt tacagcgaca ccgacttgaa cggccacgtg        60
     aacaatgcgg tctacgccac ctatatggag gagtcccgca tctccttcct gcaggaggtg       120
     ttccccggcc agcggctgcc gctcgtcatc gcctcgctgc acatcgactt ccgccaggag       180
     acgcgctatc ctgagcacac cgacgtggtg gcgcgcacgt ggctcacgcg gctcgggaga       240
     tcaagcttcg aattcttctg ccaaatctgc agcgtccgcg gcgaggtgat gtgtgaaggc       300
     accgcggtgg tcgtccacta cgacttcgag aagcggaaat ccgctccgct gccggactgg       360
     gcgcgcgaaa agctcctgcc ctacgtccgc gagcccgagg aatcgaacgt cggcgtgtga       420
//

If you have problems or comments...

PBIL Back to PBIL home page