(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE37

ALIAD_1.PE37         Location/Qualifiers
FT   CDS_pept        49400..49819
FT                   /locus_tag="Aaci_0038"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510057"
FT                   /db_xref="GeneID:8423500"
FT                   /translation="MAVVTDILSGLLMAWFSLLFIGINRFCGRVKWKDRDAWQYILLEC
FT                   MLILYFIGSLKRWYFVIPIMAFLFPVWDFLQFRAHWLSWITGASDERLRRYDDAFGDNV
FT                   YLLPKSDRRTVPDAYHTVQHVLMALNTIAVFAMLR"
FT                   /protein_id="YP_003183491.1"
     ATGGCAGTTG TGACCGACAT CCTTTCAGGG CTGTTGATGG CGTGGTTTAG TCTCTTATTC        60
     ATAGGAATCA ACCGGTTCTG CGGGAGAGTC AAGTGGAAGG ATCGCGACGC TTGGCAGTAC       120
     ATCCTGCTCG AATGCATGCT GATCCTGTAC TTTATCGGGA GCTTGAAGCG ATGGTATTTC       180
     GTGATCCCGA TCATGGCGTT TTTGTTTCCT GTGTGGGATT TTCTCCAGTT CCGTGCTCAT       240
     TGGCTTTCGT GGATCACCGG TGCCTCGGAT GAAAGGCTTC GACGTTATGA CGACGCATTC       300
     GGTGACAATG TGTACTTGCT TCCCAAATCC GACAGGAGGA CTGTGCCGGA CGCTTACCAC       360
     ACGGTCCAAC ACGTTTTGAT GGCGCTAAAC ACGATCGCGG TCTTCGCCAT GTTGCGTTGA       420
//

If you have problems or comments...

PBIL Back to PBIL home page