(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE38

ALIAD_1.PE38         Location/Qualifiers
FT   CDS_pept        complement(49866..50945)
FT                   /locus_tag="Aaci_0039"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: avn:Avin_21300
FT                   ABC transporter, ATP binding component"
FT                   /db_xref="GI:258510058"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8423501"
FT                   /translation="MKDSNAHRLSAAGVTVAHGQQVAVRRASLTIGAGEIVALVGPSGS
FT                   GKSTLLGAIAGFYPIQSGAIWIGEEMVASPTLSLPPERRRVGMVFQSHALWPQWMVVDN
FT                   VAYPLRRRGMARLLARREAESVLAAVGMDAFAARYPSELSGGQRQRVGLARALASRPEL
FT                   YLFDEPTASLDPANRETFMHEVRERIRQTGAAALYVSHQADEALSLAHRVAVMMHGEIL
FT                   QVGSPAEVYENPRTAEIARLLGPAACATGVVREVNGSGQALVQIADSEQTVRLTSAPRS
FT                   ADLGRRTLMMRPEWCELTADDEASLPCRVVRVQYVGHRTLYELESLAGRLLASHVGPPQ
FT                   YQEGQRVGWKVRRACVMEG"
FT                   /protein_id="YP_003183492.1"
     atgaaggatt cgaacgcgca tcgcctctcc gcggccggcg tcacggtggc gcacggccag        60
     caggtggcgg tcagacgcgc gtcgctgacc attggggcgg gcgagatcgt cgcgctcgtc       120
     gggccgtctg gctcgggcaa gagcacgctt ctcggcgcca tcgcggggtt ttatcccatt       180
     caatcgggcg ccatctggat tggcgaggag atggtggcct cgcccacgct ctcgcttccg       240
     ccggagcgca ggcgggttgg catggtgttt cagtcgcacg cgctctggcc gcagtggatg       300
     gtggtggaca acgtggccta tccactgcgc aggcggggca tggcgcgcct tctggcgcgg       360
     cgcgaggcgg aatcggtgct cgccgcggtg ggcatggacg cgtttgccgc gcgctatccg       420
     tcggaactct ccggcggcca gcgccagcgc gtcgggctcg cgcgggcgct cgcgtcgagg       480
     ccggagctgt acttgttcga cgaacccacc gcgagcctcg atccggccaa ccgcgaaacc       540
     ttcatgcacg aggtgcggga gcggattcga cagacggggg cggccgcgct gtacgtgagc       600
     caccaagcgg acgaggcgct gtctttggcg caccgcgtgg ccgtcatgat gcacggggag       660
     atcctgcagg tgggatctcc cgcggaggtg tacgagaacc cgcgcacggc cgagatcgcc       720
     cggcttttgg ggccggccgc gtgcgcgacg ggcgtggtgc gcgaggtgaa cgggagcggg       780
     caggcgcttg tgcaaatcgc ggacagcgag cagacggttc gactgacgtc cgcgccgcgc       840
     tcggccgatc tcggccgcag gacgctcatg atgaggccgg agtggtgcga actcaccgcc       900
     gacgacgagg cgtccctgcc ttgccgcgtg gtgcgcgtgc aatacgtggg gcaccggacg       960
     ctgtacgaac tcgagtccct cgccgggcgg ctcttggcga gtcacgtggg cccgccgcaa      1020
     taccaggaag ggcagcgcgt ggggtggaaa gtgcggcgcg cctgcgtgat ggaaggatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page