(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE4

ALIAD_1.PE4          Location/Qualifiers
FT   CDS_pept        3039..4154
FT                   /locus_tag="Aaci_0004"
FT                   /gene_family="HOG000269559" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gme:Gmet_0003 recombination
FT                   protein F"
FT                   /db_xref="GI:258510024"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="GeneID:8423462"
FT                   /translation="MDIRRVELHDFRNYAKAEIELSPGVNVLVGENGQGKTNALEAMLL
FT                   IAVGKSHRAHRDRDLIRWEQDRARILLEASTRYGDRRLTLELGPEGRRAFANGVQVGRM
FT                   TEFVGQVQVVLFAPEDLDLVKGSPRVRRRFLDTELGQMEPLYLHHLSLYNRALLQRNRW
FT                   LKTAPLSPDDDVLATFDRQIAFHGAHVIHRRLRFLARLRAYAARIYSDIASGREEFALA
FT                   YRSSVSGVEEGMSVEEMADTVQRALEKNRAQDLRFGTTSAGPHRDDILLFLDGREVHTA
FT                   ASQGQQRTIALSLRLAEIDFMHEELGEYPVLLLDDVLSELDDLRQRNLVLGMSRKVQTV
FT                   ITTTSLNRLGQELDDFRLFRVCSGIIAEERV"
FT                   /protein_id="YP_003183458.1"
     ATGGACATCC GCCGCGTTGA ACTCCACGAC TTTCGCAACT ATGCGAAGGC CGAGATCGAG        60
     TTGTCGCCAG GAGTGAACGT GCTCGTCGGC GAGAACGGCC AGGGAAAGAC GAACGCCCTG       120
     GAAGCGATGC TGCTCATCGC CGTGGGCAAG TCGCACAGGG CTCATCGGGA TCGCGATCTC       180
     ATCCGCTGGG AACAGGACCG CGCGCGCATC CTGTTGGAGG CCTCGACGCG GTACGGAGAC       240
     CGGCGCCTGA CGTTGGAACT GGGGCCAGAG GGGCGCAGGG CGTTCGCCAA CGGCGTTCAG       300
     GTGGGCCGGA TGACCGAGTT TGTCGGCCAG GTGCAGGTGG TGCTCTTTGC GCCGGAGGAC       360
     CTCGATCTCG TCAAGGGCAG TCCCCGCGTT CGGCGCAGGT TTCTCGACAC GGAACTGGGA       420
     CAGATGGAGC CCTTGTATCT CCACCACCTG AGCCTTTACA ATCGCGCGCT CTTGCAGCGA       480
     AACCGCTGGC TGAAGACCGC ACCGCTGTCT CCGGACGACG ACGTGCTCGC CACGTTTGAC       540
     CGACAGATTG CCTTTCACGG GGCGCACGTG ATTCACCGGC GCCTCCGGTT TCTCGCGCGG       600
     TTGCGCGCAT ACGCCGCTCG CATCTACAGC GACATCGCGA GCGGCCGGGA AGAGTTTGCG       660
     CTCGCGTACC GAAGTTCGGT CTCCGGCGTC GAGGAAGGCA TGAGCGTGGA GGAGATGGCA       720
     GACACCGTGC AACGCGCGCT CGAAAAAAAC CGGGCGCAGG ATCTGCGCTT TGGCACGACG       780
     AGCGCCGGCC CCCACCGGGA CGACATCCTG CTCTTTCTCG ACGGCCGGGA GGTGCACACG       840
     GCCGCCAGCC AGGGACAGCA GCGGACCATT GCGCTGTCGC TTCGGCTCGC CGAGATCGAT       900
     TTCATGCACG AGGAGCTCGG CGAGTATCCC GTGCTGCTGC TCGACGACGT CCTGTCCGAA       960
     CTCGACGATC TCCGCCAGCG CAACCTCGTG CTTGGGATGA GCCGCAAGGT GCAGACGGTC      1020
     ATCACCACGA CCAGCCTCAA TCGGCTCGGC CAGGAGCTGG ACGATTTCCG GCTGTTCCGA      1080
     GTTTGTTCTG GTATAATAGC CGAAGAACGT GTCTGA                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page