(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE40

ALIAD_1.PE40         Location/Qualifiers
FT   CDS_pept        complement(52588..53598)
FT                   /locus_tag="Aaci_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mxa:MXAN_7114 ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="GI:258510060"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:8423503"
FT                   /translation="MLMKGLSVAAAAVVVAAGVAAWHAEQHPHAPAQAAASAQGAKPAG
FT                   TVTVYAALTQQNAQALAQAFEAYDPAARVQMVTTGTGALVTRLESEAKAHAIGADMVLL
FT                   ADPTAADTLAAQGILSREKPSAASHLPSADQGANWVGAYVFHDVIVYHKGMSLPVPRSW
FT                   RDLTNAAYKGEVEIGDPSYSGTTMAFVGMMETRYGWNYFETLKQNGAAVQSSVKTVADD
FT                   VASGKVDVGMTNDSAAFTLVKQESPIGVVWPQDGAIVVPGPLAFVKGHETPVAKAFANW
FT                   LLSPAGQKVVASVGLSPVLGASPTVPKGASLTQVPWAQLERDRANILREFAQIFR"
FT                   /protein_id="YP_003183494.1"
     atgctcatga agggattgag cgtcgccgcg gcggcggtag tcgtcgcggc gggtgtcgcc        60
     gcgtggcacg ctgagcaaca tccccatgcc cccgcgcagg ccgcggcgag tgcgcaaggg       120
     gcgaagcccg cgggcaccgt cacagtgtac gccgcgctga cccagcagaa cgcgcaggcg       180
     ctggcgcagg cgtttgaggc gtacgatccg gccgcgcgcg tgcagatggt gaccacgggc       240
     acgggcgcgc tcgtgacgcg gctcgagtcg gaggccaagg cgcacgccat cggcgcggat       300
     atggtgctct tggccgatcc gaccgcggcg gacaccttgg ccgcccaggg cattctctcg       360
     cgcgagaagc cgtctgccgc aagccacctg ccgagcgcgg atcagggcgc gaattgggtg       420
     ggggcgtacg tgtttcacga cgtgatcgtg taccacaaag gcatgtccct gcctgtgccc       480
     cgttcgtggc gggacctcac caacgccgcg tacaagggcg aggtggaaat cggcgatccg       540
     tcctattccg gcaccaccat ggcgtttgtc ggcatgatgg agacgcgcta cggctggaac       600
     tactttgaga cgctgaagca gaacggcgcg gcggtgcagt cgtcggtgaa gaccgtggcg       660
     gacgacgtcg cgagcggcaa ggtggacgtg ggcatgacca acgacagcgc cgcgttcacg       720
     ctcgtgaaac aagaatcgcc catcggtgtg gtgtggccgc aggacggcgc catcgtggtg       780
     ccggggcctc tggcgttcgt caaggggcac gagacgccgg tggccaaggc gtttgccaac       840
     tggctcctga gcccggccgg tcagaaggtg gtggcgtccg tcggcctgtc gcccgtcctc       900
     ggcgcgtctc ccacggtgcc gaagggcgcg tcgctgacgc aggtgccctg ggcgcagttg       960
     gaacgagacc gggcgaacat cctccgcgag tttgcccaga tcttccgatg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page