(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE41

ALIAD_1.PE41         Location/Qualifiers
FT   CDS_pept        complement(53713..54513)
FT                   /locus_tag="Aaci_0042"
FT                   /gene_family="HOG000276829" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /codon_start="1"
FT                   /product="ABC-2 type transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ank:AnaeK_4023
FT                   ABC-2 type transporter"
FT                   /db_xref="GI:258510061"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR013526"
FT                   /db_xref="GeneID:8423504"
FT                   /translation="MQQTSFEAIQARASMATTLRQSLTMAYRGLLKMRRTPEQLFDVTL
FT                   QPIIFTLMFTYIFGGAISGNSQNYLPLVIPGILVQTVITASVVTGVQLREDMDKGVFDR
FT                   FRALPIARMAPLAGALLADMVRYLLATVLIFTVGYLMGYHPRGGLAHVAIAALLVIVCA
FT                   FALSWIFAFFGVVARTAASVQGISMLILFPLTFLSNAFAPVNTMPKWLQVFVNVNPLSH
FT                   LIAAVRSLANQGQATPDIAISLGGAVAIMLVFAPLAVRMYMRKA"
FT                   /protein_id="YP_003183495.1"
     atgcaacaga catcgtttga agccatccag gcgcgcgcct ccatggcgac cacgctgcgc        60
     cagtcgctca ccatggccta ccgcggcctg ttgaagatgc gccggacgcc agagcaactg       120
     ttcgacgtca cgctgcaacc catcatcttt acgctcatgt tcacctacat cttcgggggc       180
     gccatctccg gcaactcaca gaactatttg ccgctcgtca tcccgggcat cctcgtgcag       240
     acggtcatca ccgcatccgt cgtcaccggc gtccagctgc gcgaagacat ggacaagggc       300
     gtgttcgatc gcttccgcgc cctgcccatc gcccgcatgg cgccactcgc cggggcgctc       360
     ctcgccgaca tggtgaggta ccttttggcc acggtcctca tcttcaccgt ggggtacctc       420
     atgggctatc acccacgtgg gggccttgcc cacgtcgcca tcgccgcgct gctcgtcatc       480
     gtgtgcgcgt tcgccctcag ctggatcttc gcattcttcg gcgtcgtggc gcggacggcg       540
     gcgagcgtgc agggcatctc gatgctcatc ctgttcccgc tcacgttcct gtcgaacgcc       600
     ttcgcgcccg tcaacaccat gcctaagtgg ctgcaggtgt tcgtcaacgt caatccactc       660
     tcccacctga ttgccgccgt gcggtcgctc gccaatcagg gtcaggcaac ccccgatatc       720
     gccatctcgc tcggcggcgc cgtggccatc atgctggtgt ttgcccccct tgcggtgcgg       780
     atgtacatgc gcaaggcgtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page