(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE42

ALIAD_1.PE42         Location/Qualifiers
FT   CDS_pept        complement(54513..55526)
FT                   /locus_tag="Aaci_0043"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /codon_start="1"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: aeh:Mlg_2715 daunorubicin resistance ABC
FT                   transporter ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:258510062"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8423505"
FT                   /translation="MQSLKTPTNRLTAATGADALAIEAVDLVKAFGPHRAVDGVSLSVQ
FT                   VGTVYGLLGPNGAGKTTTVRMLATLLRPDAGAARIFGHDVVKDAQRVRQLIGVTGQYAS
FT                   VDETLTAAENLVLFARLLGQSRREARATTERLLGQFGLTEARNRPLKQFSGGMRRRLDL
FT                   AASLIATPPLIFLDEPTTGLDPRTRAQMWDTIRQLVREGTTVLLTTQYLDEADQLANRI
FT                   AVIDRGRVIAEGTPDELKSSVGRSSLHLTFANPEDVPRARALVEAALGAQATPSPEGRR
FT                   IIAPLADTSVVPDLLVALRAAGIDITELGVQKPTLDEVFLALTGHEAETADEGESD"
FT                   /protein_id="YP_003183496.1"
     atgcagtctc tcaaaacgcc gacgaatcgc ctcacagccg ccacgggcgc cgacgcgctc        60
     gccatcgaag cggtcgatct cgtcaaggcc ttcggtccac atcgcgccgt cgacggcgtc       120
     agcctgtccg tgcaggtcgg cacggtgtac ggcctgctcg gccccaacgg ggccggcaag       180
     acgaccacgg tgcgcatgct cgcgacgctt ctgcgcccag acgcaggtgc ggcgcgcatc       240
     ttcggccacg acgtcgtgaa ggacgcgcaa cgcgtgcgcc agctcatcgg cgtgaccggt       300
     cagtatgcct ccgtcgacga gacgctcacc gccgcggaaa acctggtgct cttcgcgcgc       360
     ctcctcggcc agagccgccg cgaggcgcgg gcgacgacag agcgcctgct cggacagttc       420
     ggcctcaccg aggcgcgcaa tcgcccgctg aagcagtttt ccggcggcat gcggcgccgc       480
     ctggatctgg cggccagcct catcgccacg ccgccgctca tcttccttga cgaacccacc       540
     accggcctcg atccgcgcac ccgcgcccaa atgtgggaca ccatccggca gctcgtgcgc       600
     gaaggcacaa ccgtgctcct gaccacgcaa tatttggacg aggcggacca gctggcgaat       660
     cgaatcgccg tgatcgatcg cggccgcgtc attgcggaag gcacgccgga cgagctgaag       720
     tcgtcggtgg gacggtcctc cctgcacctc accttcgcca acccggagga cgtgccgcgg       780
     gctcgcgccc tcgtggaagc ggcgcttggc gcgcaggcca cgccatcgcc cgaggggcgc       840
     cggatcatcg cgcccttggc cgacacgagc gtcgtgccgg atctgctcgt ggcgctgagg       900
     gcggccggca tcgacatcac cgaactcggc gtgcaaaagc cgacgctgga cgaggtgttc       960
     ctcgccctca ccggccacga ggccgaaacc gccgacgaag gagagagtga ctga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page