(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE43

ALIAD_1.PE43         Location/Qualifiers
FT   CDS_pept        55675..56349
FT                   /locus_tag="Aaci_0044"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: dds:Ddes_0567 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="GI:258510063"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:8423506"
FT                   /translation="MATILVADDEPHIRELVRSTLEREGHRVVEAADGREAADAVAREP
FT                   VQLAVIDVMMPEVDGFELTRWLREERDVPILLLTALGETSHKVRGLRLGADDYLVKPFA
FT                   PEELVARVEALLRRYRIRADGALDLAVLRLLSDTYEVEANGERMALPPKEFQLLFTLAA
FT                   SAGRTLSRDKLIEEVWGYDYAGDERTVDVHIKRLRVKFPEDVYPFRIRTVRGLGYRLEV
FT                   NA"
FT                   /protein_id="YP_003183497.1"
     ATGGCGACCA TCCTCGTGGC CGACGACGAG CCTCACATCC GCGAACTCGT GCGCAGCACG        60
     CTGGAGCGGG AGGGGCATCG GGTGGTGGAG GCGGCGGACG GGCGCGAGGC GGCGGATGCG       120
     GTGGCCCGTG AGCCGGTGCA GCTCGCCGTG ATCGACGTGA TGATGCCGGA GGTGGACGGG       180
     TTCGAGCTGA CGCGGTGGTT GCGCGAAGAG CGCGATGTGC CGATTCTGCT CCTGACCGCG       240
     CTCGGGGAGA CAAGCCACAA GGTGCGCGGC CTCCGGCTCG GCGCGGACGA CTACCTCGTC       300
     AAGCCGTTCG CCCCCGAGGA GCTCGTGGCG CGCGTCGAGG CGCTCCTGCG CCGCTACCGC       360
     ATTCGGGCGG ACGGCGCGCT CGATCTCGCC GTACTCCGTC TCCTCTCGGA CACGTATGAA       420
     GTCGAGGCGA ACGGGGAGCG CATGGCGCTT CCGCCGAAGG AGTTTCAGCT TCTGTTCACG       480
     CTGGCCGCGT CGGCGGGCAG GACGCTCTCC CGCGACAAGC TGATTGAAGA GGTGTGGGGG       540
     TACGACTACG CGGGGGACGA GCGGACGGTG GACGTGCACA TCAAGCGGTT GCGCGTCAAG       600
     TTCCCCGAGG ACGTGTATCC GTTTCGCATC CGCACCGTGC GCGGGTTGGG CTATCGCCTG       660
     GAGGTGAACG CGTGA                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page