(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE44

ALIAD_1.PE44         Location/Qualifiers
FT   CDS_pept        56346..57458
FT                   /locus_tag="Aaci_0045"
FT                   /gene_family="HOG000079356" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: gsu:GSU1101 sensory box histidine kinase"
FT                   /db_xref="GI:258510064"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:8423507"
FT                   /translation="MKERAASRGSDDDFRARHQRWQWREALDRLLWMSCWSFVLLSASY
FT                   GVVRLMGRALGWRPVPYGQLMIIGGVGVVMLALVALLWNALGFDRDDRLFFRILDSLSE
FT                   IGRGNFSARAMLEVRRGFPDHPMNQLVLHVREMAEGLERIEQMRQEFVANVSHEMQTPL
FT                   TSILGFVKALKSDGLSEGERRHYLDIIEAESERLSRLADNLLKLTSLESGHHPVTLTRF
FT                   RLDRQLREVAIACEPLWTEKGLFLDMQVEPVELEGDEDLLGQVWMNLLSNAIKFTEPGG
FT                   RIQVRLEKEETGVCVSVADTGIGIRPEDVSRVFTRFFKADRSRGKPGNGLGLAIAKRIV
FT                   EMHRGDISVESEPGRGSTFKVHLPYTQGGR"
FT                   /protein_id="YP_003183498.1"
     GTGAAGGAGC GAGCCGCCTC GCGGGGGTCT GACGACGACT TCCGCGCCCG TCATCAGCGC        60
     TGGCAGTGGC GCGAAGCGTT GGACAGGCTC CTCTGGATGT CGTGTTGGTC GTTTGTGTTG       120
     CTGAGCGCCT CGTACGGCGT GGTGCGCCTC ATGGGGCGTG CACTCGGCTG GCGGCCCGTG       180
     CCGTACGGCC AACTGATGAT CATCGGCGGC GTGGGTGTGG TGATGCTCGC GCTCGTCGCG       240
     CTTCTCTGGA ACGCGCTTGG CTTCGATCGC GATGATCGCC TCTTTTTCCG CATTCTCGAC       300
     TCCTTGAGCG AGATTGGCCG CGGGAATTTC AGCGCCCGCG CCATGCTGGA GGTCCGGCGT       360
     GGCTTTCCGG ATCACCCCAT GAACCAGCTG GTGCTGCACG TTCGCGAGAT GGCGGAAGGG       420
     CTCGAGCGCA TCGAACAGAT GCGCCAGGAG TTTGTGGCGA ACGTGTCGCA CGAGATGCAG       480
     ACGCCGCTCA CGTCCATCCT CGGCTTCGTG AAGGCGCTCA AATCGGACGG ACTGTCGGAA       540
     GGCGAGCGGC GCCACTATCT CGACATCATC GAGGCGGAGA GCGAGCGGTT GTCCCGCCTG       600
     GCGGACAACC TGCTCAAGCT CACCTCGCTC GAATCGGGCC ATCACCCGGT GACGCTGACG       660
     CGCTTCCGTC TCGACCGCCA ACTGCGCGAG GTGGCGATTG CGTGCGAGCC GCTGTGGACG       720
     GAGAAAGGTC TCTTCCTCGA CATGCAGGTG GAGCCCGTCG AGTTGGAGGG CGACGAGGAC       780
     CTCCTCGGCC AGGTGTGGAT GAACCTCTTG TCAAACGCCA TCAAGTTCAC GGAGCCGGGC       840
     GGCCGAATTC AAGTGCGCCT CGAGAAGGAA GAAACAGGCG TCTGCGTGTC GGTTGCGGAC       900
     ACGGGCATCG GCATCCGTCC GGAGGATGTG AGCCGCGTGT TCACTCGCTT CTTCAAGGCG       960
     GACCGGTCGC GCGGCAAGCC GGGCAATGGG CTGGGCCTCG CCATCGCCAA GCGCATTGTG      1020
     GAGATGCACC GCGGGGACAT CTCGGTCGAA AGCGAGCCAG GTCGTGGGTC GACATTCAAG      1080
     GTGCACCTAC CGTATACTCA GGGTGGAAGA TGA                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page