(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE45

ALIAD_1.PE45         Location/Qualifiers
FT   CDS_pept        57519..57710
FT                   /locus_tag="Aaci_0046"
FT                   /gene_family="HOG000101080" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510065"
FT                   /db_xref="GeneID:8423508"
FT                   /translation="MLVAEILLLLLYAAIEFAVGLLFAWAFGRMFRVRLSRKTRLWMAT
FT                   AWAVLGVIPTALGINGGL"
FT                   /protein_id="YP_003183499.1"
     GTGCTCGTCG CCGAAATCCT CCTTCTTCTC CTGTACGCGG CGATTGAATT CGCCGTGGGC        60
     CTGCTCTTTG CCTGGGCGTT TGGGCGCATG TTTCGCGTGA GGTTGTCGAG GAAGACGAGG       120
     CTGTGGATGG CGACCGCCTG GGCCGTTCTC GGCGTGATTC CCACCGCGCT TGGAATCAAC       180
     GGAGGATTGT GA                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page